2FG6C

N-succinyl-l-ornithine transcarbamylase from b. fragilis complexed with sulfate and n-succinyl-l-norvaline
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 175-240 66 1-174, 241-321 174 81 knot
Chain Sequence
GSHMKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKPEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 175-241 67 1-174, 242-321 174 80 knot
view details
2.1 171-237 67 1-7, 242-321 8-170, 238-241 7 80 slipknot
view details
3.1 176-287 112 1-174, 301-321 175-175, 288-300 174 21 slipknot
sequence length 321
structure length 321
publication title Structure and catalytic mechanism of a novel N-succinyl-L-ornithine transcarbamylase in arginine biosynthesis of Bacteroides fragilis.
pubmed doi rcsb
molecule tags Transferase
molecule keywords putative ornithine carbamoyltransferase
source organism Bacteroides fragilis
total genus Genus: 114
ec nomenclature ec 2.1.3.-:
pdb deposition date 2005-12-21
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fg6C02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fg6C01
2G7MC 3KZNA 3M4JA 1YH1A 3KZCA 3M4NA 1JS1X 3L04A 3M5DA 3L06A 3KZKA 2FG6C 3M5CA 3KZOA 3KZMA 3L02A 3L05A
chains in the KnotProt database with same CATH superfamily
1II9A 1P6XA 1KI2A 1YH1A 1E2IA 1E2NA 1KI3A 1JS1X 1KI6A 1KIMA 1R4NB 1GKUB 1E2JA 3L06A 1YVEI 2XTJA 1E2HA 2FG6C 1OF1A 3KZMA 1DBIA 4IVRA 3L02A 3RDPA 1OSNA 1E2PA 2G7MC 3L05A 1KI4A 3M4NA 1KI7A 2VTKA 1KI6B 1VTKA 3KZKA 1P75A 1E2KA 3VTKA 1YRLA 3F0TA 4IVPA 1KI8A 1QHIA 3FR7A 1P73A 4IVQA 3FR8A 1E2MA 3KZOA 1QMGA 4JBYA 3M5DA 1P7CA 3KZNA 3M4JA 1R4MB 3KZCA 1P72A 3L04A 1LNSA 3M5CA 1E2LA 2KI5A 4JBXA 1F48A 3FSGA
chains in the KnotProt database with same CATH topology
1YH1A 1JS1X 1GKUB 3L06A 2XTJA 2FG6C 3KZMA 1DBIA 3L02A 3L05A 2G7MC 3M4NA 3KZKA 3KZOA 3M5DA 3KZNA 3M4JA 3KZCA 3L04A 1LNSA 3M5CA 3FSGA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2G7M C;  3KZN A;  3M4J A;  1YH1 A;  3KZC A;  3M4N A;  1JS1 X;  3L04 A;  3M5D A;  3L06 A;  3KZK A;  2FG6 C;  3M5C A;  3KZO A;  3KZM A;  3L02 A;  3L05 A; 
#chains in the KnotProt database with same CATH topology
 1II9 A;  1P6X A;  1KI2 A;  1YH1 A;  1E2I A;  1E2N A;  1KI3 A;  1JS1 X;  1KI6 A;  1KIM A;  1R4N B;  1GKU B;  1E2J A;  3L06 A;  1YVE I;  2XTJ A;  1E2H A;  2FG6 C;  1OF1 A;  3KZM A;  1DBI A;  4IVR A;  3L02 A;  3RDP A;  1OSN A;  1E2P A;  2G7M C;  3L05 A;  1KI4 A;  3M4N A;  1KI7 A;  2VTK A;  1KI6 B;  1VTK A;  3KZK A;  1P75 A;  1E2K A;  3VTK A;  1YRL A;  3F0T A;  4IVP A;  1KI8 A;  1QHI A;  3FR7 A;  1P73 A;  4IVQ A;  3FR8 A;  1E2M A;  3KZO A;  1QMG A;  4JBY A;  3M5D A;  1P7C A;  3KZN A;  3M4J A;  1R4M B;  3KZC A;  1P72 A;  3L04 A;  1LNS A;  3M5C A;  1E2L A;  2KI5 A;  4JBX A;  1F48 A;  3FSG A; 
#chains in the KnotProt database with same CATH homology
 1YH1 A;  1JS1 X;  1GKU B;  3L06 A;  2XTJ A;  2FG6 C;  3KZM A;  1DBI A;  3L02 A;  3L05 A;  2G7M C;  3M4N A;  3KZK A;  3KZO A;  3M5D A;  3KZN A;  3M4J A;  3KZC A;  3L04 A;  1LNS A;  3M5C A;  3FSG A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling