2FG6C

N-succinyl-l-ornithine transcarbamylase from b. fragilis complexed with sulfate and n-succinyl-l-norvaline
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 175-240 66 1-174, 241-321 174 81 knot
Chain Sequence
GSHMKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKPEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 175-241 67 1-174, 242-321 174 80 knot
view details
2.1 171-237 67 1-7, 242-321 8-170, 238-241 7 80 slipknot
view details
3.1 176-287 112 1-174, 301-321 175-175, 288-300 174 21 slipknot
sequence length 321
structure length 321
publication title Structure and catalytic mechanism of a novel N-succinyl-L-ornithine transcarbamylase in arginine biosynthesis of Bacteroides fragilis.
pubmed doi rcsb
molecule tags Transferase
molecule keywords putative ornithine carbamoyltransferase
source organism Bacteroides fragilis
total genus Genus: 114
ec nomenclature ec 2.1.3.-:
pdb deposition date 2005-12-21
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fg6C02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fg6C01
3L06A 3KZKA 3L02A 3M5DA 3KZMA 3L05A 3M4JA 2FG6C 1JS1X 1YH1A 3KZCA 3KZNA 3M5CA 3KZOA 3M4NA 2G7MC 3L04A
chains in the KnotProt database with same CATH superfamily
3L06A 3M5DA 2VTKA 3KZNA 1QHIA 1YVEI 1KI7A 1E2LA 1VTKA 2G7MC 1YRLA 1P7CA 3L02A 3F0TA 1E2IA 3M4JA 4IVQA 1KI2A 1GKUB 4JBXA 4JBYA 1KIMA 1KI6A 3KZKA 1E2PA 1E2JA 3M4NA 3KZMA 3FR8A 1QMGA 2FG6C 3FSGA 3FR7A 1YH1A 1KI8A 1P6XA 1P73A 1R4MB 1E2NA 1E2MA 3RDPA 1P72A 2XTJA 3L05A 1E2HA 1II9A 1R4NB 1JS1X 1KI3A 2KI5A 3KZCA 1KI4A 3M5CA 4IVPA 1OF1A 1F48A 1LNSA 1P75A 3VTKA 4IVRA 3KZOA 1KI6B 1E2KA 1OSNA 1DBIA 3L04A
chains in the KnotProt database with same CATH topology
3L06A 3M5DA 3KZNA 2G7MC 3L02A 3M4JA 1GKUB 3M4NA 3KZKA 3KZMA 2FG6C 3FSGA 1YH1A 2XTJA 3L05A 1JS1X 3KZCA 3M5CA 1DBIA 1LNSA 3KZOA 3L04A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3L06 A;  3KZK A;  3L02 A;  3M5D A;  3KZM A;  3L05 A;  3M4J A;  2FG6 C;  1JS1 X;  1YH1 A;  3KZC A;  3KZN A;  3M5C A;  3KZO A;  3M4N A;  2G7M C;  3L04 A; 
#chains in the KnotProt database with same CATH topology
 3L06 A;  3M5D A;  2VTK A;  3KZN A;  1QHI A;  1YVE I;  1KI7 A;  1E2L A;  1VTK A;  2G7M C;  1YRL A;  1P7C A;  3L02 A;  3F0T A;  1E2I A;  3M4J A;  4IVQ A;  1KI2 A;  1GKU B;  4JBX A;  4JBY A;  1KIM A;  1KI6 A;  3KZK A;  1E2P A;  1E2J A;  3M4N A;  3KZM A;  3FR8 A;  1QMG A;  2FG6 C;  3FSG A;  3FR7 A;  1YH1 A;  1KI8 A;  1P6X A;  1P73 A;  1R4M B;  1E2N A;  1E2M A;  3RDP A;  1P72 A;  2XTJ A;  3L05 A;  1E2H A;  1II9 A;  1R4N B;  1JS1 X;  1KI3 A;  2KI5 A;  3KZC A;  1KI4 A;  3M5C A;  4IVP A;  1OF1 A;  1F48 A;  1LNS A;  1P75 A;  3VTK A;  4IVR A;  3KZO A;  1KI6 B;  1E2K A;  1OSN A;  1DBI A;  3L04 A; 
#chains in the KnotProt database with same CATH homology
 3L06 A;  3M5D A;  3KZN A;  2G7M C;  3L02 A;  3M4J A;  1GKU B;  3M4N A;  3KZK A;  3KZM A;  2FG6 C;  3FSG A;  1YH1 A;  2XTJ A;  3L05 A;  1JS1 X;  3KZC A;  3M5C A;  1DBI A;  1LNS A;  3KZO A;  3L04 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling