1JS1X

Crystal structure of a new transcarbamylase from the anaerobic bacterium bacteroides fragilis at 2.0 a resolution
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 172-237 66 1-171, 238-324 171 87 knot
Chain Sequence
MKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKPEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYTGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLPHHHHHH
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 172-237 66 1-171, 238-324 171 87 knot
view details
2.1 169-234 66 1-123, 238-324 124-168, 235-237 123 87 slipknot
sequence length 324
structure length 324
publication title Crystal structure of a transcarbamylase-like protein from the anaerobic bacterium Bacteroides fragilis at 2.0 A resolution.
pubmed doi rcsb
molecule tags Transferase
molecule keywords Transcarbamylase
source organism Bacteroides fragilis
total genus Genus: 110
ec nomenclature ec 2.1.3.9: N-acetylornithine carbamoyltransferase.
pdb deposition date 2001-08-15
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1js1X02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1js1X01
3L02A 1JS1X 2FG7X 3KZNA 3KZOA 3L05A 3M5CA 3L04A 2G7MC 3KZKA 2FG7C 3L06A 3M5DA 3M4JA 1YH1A 3KZCA 3KZMA 3M4NA 2FG6C
chains in the KnotProt database with same CATH superfamily
3L02A 1KI2A 3FSGA 1E2JA 1JS1X 1E2IA 1F48A 1DBIA 1KI7A 2FG7X 4IVPA 3KZNA 4JBYA 1E2MA 1E2LA 3FR7A 3VTKA 1QHIA 1E2KA 3KZOA 1LNSA 1P75A 3L05A 3FR8A 1E2NA 1R4MB 1KIMA 1P6XA 1YRLA 3M5CA 3L04A 4IVRA 1E2HA 4JBXA 1P72A 2XTJA 1II9A 2G7MC 1P73A 3KZKA 1R4NB 1QMGA 1P7CA 3RDPA 1KI6B 1KI6A 1OSNA 1OF1A 2FG7C 4IVQA 1VTKA 3L06A 3F0TA 1YVEI 3M5DA 3M4JA 1YH1A 3KZCA 1KI8A 3KZMA 1KI3A 1E2PA 1KI4A 3M4NA 1GKUB 2KI5A 2FG6C 2VTKA
chains in the KnotProt database with same CATH topology
3L02A 1JS1X 1DBIA 2FG7X 3KZNA 3KZOA 1LNSA 3L05A 3M5CA 3L04A 2XTJA 2G7MC 3KZKA 2FG7C 3L06A 3M5DA 3M4JA 1YH1A 3KZCA 3KZMA 3M4NA 2FG6C 1GKUB 3FSGA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3L02 A;  1JS1 X;  2FG7 X;  3KZN A;  3KZO A;  3L05 A;  3M5C A;  3L04 A;  2G7M C;  3KZK A;  2FG7 C;  3L06 A;  3M5D A;  3M4J A;  1YH1 A;  3KZC A;  3KZM A;  3M4N A;  2FG6 C; 
#chains in the KnotProt database with same CATH topology
 3L02 A;  1KI2 A;  3FSG A;  1E2J A;  1JS1 X;  1E2I A;  1F48 A;  1DBI A;  1KI7 A;  2FG7 X;  4IVP A;  3KZN A;  4JBY A;  1E2M A;  1E2L A;  3FR7 A;  3VTK A;  1QHI A;  1E2K A;  3KZO A;  1LNS A;  1P75 A;  3L05 A;  3FR8 A;  1E2N A;  1R4M B;  1KIM A;  1P6X A;  1YRL A;  3M5C A;  3L04 A;  4IVR A;  1E2H A;  4JBX A;  1P72 A;  2XTJ A;  1II9 A;  2G7M C;  1P73 A;  3KZK A;  1R4N B;  1QMG A;  1P7C A;  3RDP A;  1KI6 B;  1KI6 A;  1OSN A;  1OF1 A;  2FG7 C;  4IVQ A;  1VTK A;  3L06 A;  3F0T A;  1YVE I;  3M5D A;  3M4J A;  1YH1 A;  3KZC A;  1KI8 A;  3KZM A;  1KI3 A;  1E2P A;  1KI4 A;  3M4N A;  1GKU B;  2KI5 A;  2FG6 C;  2VTK A; 
#chains in the KnotProt database with same CATH homology
 3L02 A;  1JS1 X;  1DBI A;  2FG7 X;  3KZN A;  3KZO A;  1LNS A;  3L05 A;  3M5C A;  3L04 A;  2XTJ A;  2G7M C;  3KZK A;  2FG7 C;  3L06 A;  3M5D A;  3M4J A;  1YH1 A;  3KZC A;  3KZM A;  3M4N A;  2FG6 C;  1GKU B;  3FSG A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling