1OSNA

Crystal structure of varicella zoster virus thymidine kinase in complex with bvdu-mp and adp
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 6-123 118 1-5 311-331 124-310 5 21 slipknot
Chain Sequence
VKMGVLRIYLDGAYGIGKTTAAEEFLHHFAITPNRILLIGEPLSYWRNLAGEDAICGIYGTQTRRLNGDVSPEDAQRLTAHFQSLFCSPHAIMHAKISALMDTSTSDLVQVNKEPYKIMLSDRHPIASTICFPLSRYLVGDMSPAALPGLLFTLPAEPPGTNLVVCTVSLPSHLSRVS------ETVNLPFVMVLRNVYIMLINTIIFLKTNNWHAGWNTLSFCNDVFKQKLQKSECIKLREVPGIEDTLFAVLKLPELCGEFGNILPLWAWGMETLSNCLRSMSPFVLSLEQTPQHAAQELKTLLPQMTPANMSSGAWNILKELVNAVQD
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 8-123 116 1-7 141-325 124-140 7 185 slipknot
view details
2.1 9-162 154 1-8 270-325 163-269 8 56 slipknot
view details
2.1 9-269 261 1-8 296-325 270-295 8 30 slipknot
view details
2.1 8-295 288 1-7 306-325 296-305 7 20 slipknot
view details
3.1 3-305 303 1-2 308-325 306-307 2 18 slipknot
sequence length 331
structure length 325
publication title Crystal structure of varicella zoster virus thymidine kinase
pubmed doi rcsb
molecule tags Transferase
molecule keywords Thymidine kinase
source organism Human herpesvirus 3
missing residues 179-184
total genus Genus: 104
ec nomenclature ec 2.7.1.21: Thymidine kinase.
pdb deposition date 2003-03-20
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00693 Herpes_TK Thymidine kinase from herpesvirus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1osnA00
1VTKA 4JBXA 4IVRA 1II9A 4IVQA 1P72A 1P75A 4JBYA 1E2HA 1KI2A 1OSNA 1F48A 2VTKA 1KI6A 1QHIA 1P7CA 1KI7A 1E2PA 1P6XA 2KI5A 1E2KA 3VTKA 3F0TA 4IVPA 1E2LA 1E2NA 1E2JA 3RDPA 1KI4A 1KIMA 1KI6B 1GKUB 1P73A 1E2IA 1KI3A 1OF1A 1KI8A 1E2MA
chains in the KnotProt database with same CATH superfamily
1VTKA 3KZCA 4JBXA 4IVRA 1II9A 3M4NA 4IVQA 3L05A 1QMGA 3FSGA 1P72A 1P75A 3M4JA 3M5DA 3M5CA 3L04A 2FG7C 1YVEI 4JBYA 1DBIA 1YRLA 1JS1X 1E2HA 1KI2A 1OSNA 2FG7X 3L02A 3KZNA 3L06A 1F48A 2VTKA 1KI6A 3FR8A 1QHIA 1P7CA 1KI7A 1E2PA 2XTJA 1P6XA 2KI5A 3KZMA 1LNSA 1R4MB 1E2KA 3VTKA 1R4NB 3FR7A 3F0TA 4IVPA 1E2LA 1E2NA 1E2JA 3RDPA 1KI4A 1KIMA 2FG6C 1KI6B 1GKUB 1P73A 1E2IA 1YH1A 1KI3A 1OF1A 2G7MC 3KZKA 3KZOA 1KI8A 1E2MA
chains in the KnotProt database with same CATH topology
1VTKA 4JBXA 4IVRA 1II9A 4IVQA 1P72A 1P75A 4JBYA 1E2HA 1KI2A 1OSNA 1F48A 2VTKA 1KI6A 1QHIA 1P7CA 1KI7A 1E2PA 1P6XA 2KI5A 1E2KA 3VTKA 3F0TA 4IVPA 1E2LA 1E2NA 1E2JA 3RDPA 1KI4A 1KIMA 1KI6B 1GKUB 1P73A 1E2IA 1KI3A 1OF1A 1KI8A 1E2MA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1VTK A;  4JBX A;  4IVR A;  1II9 A;  4IVQ A;  1P72 A;  1P75 A;  4JBY A;  1E2H A;  1KI2 A;  1OSN A;  1F48 A;  2VTK A;  1KI6 A;  1QHI A;  1P7C A;  1KI7 A;  1E2P A;  1P6X A;  2KI5 A;  1E2K A;  3VTK A;  3F0T A;  4IVP A;  1E2L A;  1E2N A;  1E2J A;  3RDP A;  1KI4 A;  1KIM A;  1KI6 B;  1GKU B;  1P73 A;  1E2I A;  1KI3 A;  1OF1 A;  1KI8 A;  1E2M A; 
#chains in the KnotProt database with same CATH topology
 1VTK A;  3KZC A;  4JBX A;  4IVR A;  1II9 A;  3M4N A;  4IVQ A;  3L05 A;  1QMG A;  3FSG A;  1P72 A;  1P75 A;  3M4J A;  3M5D A;  3M5C A;  3L04 A;  2FG7 C;  1YVE I;  4JBY A;  1DBI A;  1YRL A;  1JS1 X;  1E2H A;  1KI2 A;  1OSN A;  2FG7 X;  3L02 A;  3KZN A;  3L06 A;  1F48 A;  2VTK A;  1KI6 A;  3FR8 A;  1QHI A;  1P7C A;  1KI7 A;  1E2P A;  2XTJ A;  1P6X A;  2KI5 A;  3KZM A;  1LNS A;  1R4M B;  1E2K A;  3VTK A;  1R4N B;  3FR7 A;  3F0T A;  4IVP A;  1E2L A;  1E2N A;  1E2J A;  3RDP A;  1KI4 A;  1KIM A;  2FG6 C;  1KI6 B;  1GKU B;  1P73 A;  1E2I A;  1YH1 A;  1KI3 A;  1OF1 A;  2G7M C;  3KZK A;  3KZO A;  1KI8 A;  1E2M A; 
#chains in the KnotProt database with same CATH homology
 1VTK A;  4JBX A;  4IVR A;  1II9 A;  4IVQ A;  1P72 A;  1P75 A;  4JBY A;  1E2H A;  1KI2 A;  1OSN A;  1F48 A;  2VTK A;  1KI6 A;  1QHI A;  1P7C A;  1KI7 A;  1E2P A;  1P6X A;  2KI5 A;  1E2K A;  3VTK A;  3F0T A;  4IVP A;  1E2L A;  1E2N A;  1E2J A;  3RDP A;  1KI4 A;  1KIM A;  1KI6 B;  1GKU B;  1P73 A;  1E2I A;  1KI3 A;  1OF1 A;  1KI8 A;  1E2M A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling