2FG6C

N-succinyl-l-ornithine transcarbamylase from b. fragilis complexed with sulfate and n-succinyl-l-norvaline
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 175-240 66 1-174, 241-321 174 81 knot
Chain Sequence
GSHMKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKPEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 175-241 67 1-174, 242-321 174 80 knot
view details
2.1 171-237 67 1-7, 242-321 8-170, 238-241 7 80 slipknot
view details
3.1 176-287 112 1-174, 301-321 175-175, 288-300 174 21 slipknot
sequence length 321
structure length 321
publication title Structure and catalytic mechanism of a novel N-succinyl-L-ornithine transcarbamylase in arginine biosynthesis of Bacteroides fragilis.
pubmed doi rcsb
molecule tags Transferase
molecule keywords putative ornithine carbamoyltransferase
source organism Bacteroides fragilis
total genus Genus: 114
ec nomenclature ec 2.1.3.-:
pdb deposition date 2005-12-21
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fg6C02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fg6C01
2G7MC 3KZNA 2FG6C 3L05A 3KZKA 3KZOA 3M4NA 3M5CA 3KZCA 3M5DA 3L04A 1JS1X 3KZMA 3L02A 3L06A 3M4JA 1YH1A
chains in the KnotProt database with same CATH superfamily
1E2KA 3F0TA 3L05A 3RDPA 1P75A 3M4NA 1YVEI 1R4NB 1KI6B 2KI5A 4JBYA 3L02A 1II9A 3M4JA 4IVRA 3FR7A 1YH1A 1QMGA 2VTKA 1E2NA 1OSNA 3KZNA 3KZKA 3KZOA 3FR8A 1KI2A 1E2JA 1KI4A 1JS1X 1KI8A 1P6XA 1QHIA 3M5DA 1KIMA 1R4MB 1KI6A 1OF1A 1LNSA 1VTKA 1P73A 1GKUB 1E2LA 4IVPA 1P7CA 1YRLA 1E2IA 1E2PA 1KI7A 1E2HA 1P72A 3L06A 1DBIA 1E2MA 2G7MC 2FG6C 4IVQA 3M5CA 3KZCA 1KI3A 3L04A 3VTKA 3KZMA 3FSGA 1F48A 4JBXA 2XTJA
chains in the KnotProt database with same CATH topology
3L05A 3M4NA 3L02A 3M4JA 1YH1A 3KZNA 3KZKA 3KZOA 3M5DA 1JS1X 1LNSA 1GKUB 3L06A 1DBIA 2G7MC 2FG6C 3M5CA 3KZCA 3L04A 3KZMA 3FSGA 2XTJA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2G7M C;  3KZN A;  2FG6 C;  3L05 A;  3KZK A;  3KZO A;  3M4N A;  3M5C A;  3KZC A;  3M5D A;  3L04 A;  1JS1 X;  3KZM A;  3L02 A;  3L06 A;  3M4J A;  1YH1 A; 
#chains in the KnotProt database with same CATH topology
 1E2K A;  3F0T A;  3L05 A;  3RDP A;  1P75 A;  3M4N A;  1YVE I;  1R4N B;  1KI6 B;  2KI5 A;  4JBY A;  3L02 A;  1II9 A;  3M4J A;  4IVR A;  3FR7 A;  1YH1 A;  1QMG A;  2VTK A;  1E2N A;  1OSN A;  3KZN A;  3KZK A;  3KZO A;  3FR8 A;  1KI2 A;  1E2J A;  1KI4 A;  1JS1 X;  1KI8 A;  1P6X A;  1QHI A;  3M5D A;  1KIM A;  1R4M B;  1KI6 A;  1OF1 A;  1LNS A;  1VTK A;  1P73 A;  1GKU B;  1E2L A;  4IVP A;  1P7C A;  1YRL A;  1E2I A;  1E2P A;  1KI7 A;  1E2H A;  1P72 A;  3L06 A;  1DBI A;  1E2M A;  2G7M C;  2FG6 C;  4IVQ A;  3M5C A;  3KZC A;  1KI3 A;  3L04 A;  3VTK A;  3KZM A;  3FSG A;  1F48 A;  4JBX A;  2XTJ A; 
#chains in the KnotProt database with same CATH homology
 3L05 A;  3M4N A;  3L02 A;  3M4J A;  1YH1 A;  3KZN A;  3KZK A;  3KZO A;  3M5D A;  1JS1 X;  1LNS A;  1GKU B;  3L06 A;  1DBI A;  2G7M C;  2FG6 C;  3M5C A;  3KZC A;  3L04 A;  3KZM A;  3FSG A;  2XTJ A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling