2G7MC

Crystal structure of b. fragilis n-succinylornithine transcarbamylase p90e mutant complexed with carbamoyl phosphate and n-acetylnorvaline
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 174-239 66 1-173, 240-320 173 81 knot
Chain Sequence
SHMKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKEEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 173-283 111 1-172, 284-320 172 37 knot
view details
3.1 173-239 67 1-172 284-320 240-283 172 37 slipknot
view details
2.1 171-236 66 1-24, 240-320 25-170, 237-239 24 81 slipknot
view details
2.1 175-287 113 1-172, 300-320 173-174, 288-299 172 21 slipknot
view details
3.1 175-306 132 1-172, 314-320 173-174, 307-313 172 7 slipknot
view details
3.1 175-314 140 1-172, 320-320 173-174, 315-319 172 1 slipknot
view details
3.1 175-319 145 320-320 1-172 173-174 172 0 slipknot
sequence length 320
structure length 320
publication title A single mutation in the active site swaps the substrate specificity of N-acetyl-L-ornithine transcarbamylase and N-succinyl-L-ornithine transcarbamylase.
pubmed doi rcsb
molecule tags Transferase
molecule keywords putative ornithine carbamoyltransferase
source organism Bacteroides fragilis
total genus Genus: 114
ec nomenclature ec 2.1.3.-:
pdb deposition date 2006-02-28
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2g7mC02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2g7mC01
3M4JA 3KZKA 3M4NA 2G7MC 3L06A 1JS1X 3KZMA 3KZCA 3M5CA 2FG6C 3M5DA 3KZOA 3KZNA 1YH1A 3L02A 3L05A 3L04A
chains in the KnotProt database with same CATH superfamily
1GKUB 4JBXA 1KI8A 2G7MC 3L06A 4IVRA 1QHIA 4IVQA 1VTKA 3FSGA 3M5CA 3FR8A 1KI6B 2XTJA 4IVPA 1E2LA 3KZMA 1YRLA 3KZCA 1KI6A 1KIMA 1F48A 1KI7A 1P75A 1E2IA 1E2KA 1P7CA 1II9A 1YH1A 1KI2A 1P72A 2KI5A 3M4JA 1OF1A 3VTKA 1E2PA 1OSNA 1P6XA 2FG6C 1KI3A 1P73A 4JBYA 3M5DA 1YVEI 3L02A 3L05A 3F0TA 1R4NB 3M4NA 1E2JA 2VTKA 1R4MB 3KZKA 3FR7A 1E2MA 1KI4A 1E2NA 1JS1X 1DBIA 1QMGA 3KZOA 3KZNA 3RDPA 1E2HA 1LNSA 3L04A
chains in the KnotProt database with same CATH topology
1GKUB 2G7MC 3L06A 3FSGA 3M5CA 2XTJA 3KZMA 3KZCA 3L04A 1YH1A 3M4JA 2FG6C 3M5DA 3L02A 3L05A 3KZKA 1JS1X 1DBIA 3KZOA 3KZNA 1LNSA 3M4NA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3M4J A;  3KZK A;  3M4N A;  2G7M C;  3L06 A;  1JS1 X;  3KZM A;  3KZC A;  3M5C A;  2FG6 C;  3M5D A;  3KZO A;  3KZN A;  1YH1 A;  3L02 A;  3L05 A;  3L04 A; 
#chains in the KnotProt database with same CATH topology
 1GKU B;  4JBX A;  1KI8 A;  2G7M C;  3L06 A;  4IVR A;  1QHI A;  4IVQ A;  1VTK A;  3FSG A;  3M5C A;  3FR8 A;  1KI6 B;  2XTJ A;  4IVP A;  1E2L A;  3KZM A;  1YRL A;  3KZC A;  1KI6 A;  1KIM A;  1F48 A;  1KI7 A;  1P75 A;  1E2I A;  1E2K A;  1P7C A;  1II9 A;  1YH1 A;  1KI2 A;  1P72 A;  2KI5 A;  3M4J A;  1OF1 A;  3VTK A;  1E2P A;  1OSN A;  1P6X A;  2FG6 C;  1KI3 A;  1P73 A;  4JBY A;  3M5D A;  1YVE I;  3L02 A;  3L05 A;  3F0T A;  1R4N B;  3M4N A;  1E2J A;  2VTK A;  1R4M B;  3KZK A;  3FR7 A;  1E2M A;  1KI4 A;  1E2N A;  1JS1 X;  1DBI A;  1QMG A;  3KZO A;  3KZN A;  3RDP A;  1E2H A;  1LNS A;  3L04 A; 
#chains in the KnotProt database with same CATH homology
 1GKU B;  2G7M C;  3L06 A;  3FSG A;  3M5C A;  2XTJ A;  3KZM A;  3KZC A;  3L04 A;  1YH1 A;  3M4J A;  2FG6 C;  3M5D A;  3L02 A;  3L05 A;  3KZK A;  1JS1 X;  1DBI A;  3KZO A;  3KZN A;  1LNS A;  3M4N A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling