3FSGA

Crystal structure of alpha/beta superfamily hydrolase from oenococcus oeni psu-1
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 82-216 135 1-1, 245-267 2-81, 217-244 1 23 slipknot
Chain Sequence
MKEYLTRSNISYFSIGSGTPIIFLHGLSLDKQSTCLFFEPLSNVGQYQRIYLDLPGMGNSDPISPSTSDNVLETLIEAIEEIIGARRFILYGHSYGGYLAQAIAFHLKDQTLGVFLTCPVITADHSKRLTGKHINILEEDINPVENKEYFADFLSMNVIINNQAWHDYQNLIIPGLQKEDKTFIDQLQNNYSFTFEEKLKNINYQFPFKIMVGRNDQVVGYQEQLKLINHNENGEIVLLNRTGHNLMIDQREAVGFHFDLFLDELNS
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 24-213 190 1-23 222-267 214-221 23 46 slipknot
view details
2.1 24-241 218 1-23 250-267 242-249 23 18 slipknot
view details
2.1 91-213 123 1-29, 221-267 30-90, 214-220 29 47 slipknot
view details
2.1 88-241 154 1-61, 249-267 62-87, 242-248 61 19 slipknot
sequence length 267
structure length 267
publication title Crystal structure of alpha/beta superfamily hydrolase from Oenococcus oeni PSU-1
rcsb
molecule tags Hydrolase
molecule keywords Alpha/beta superfamily hydrolase
source organism Oenococcus oeni
total genus Genus: 83
ec nomenclature
pdb deposition date 2009-01-09
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fsgA00
1LNSA 3FSGA
chains in the KnotProt database with same CATH superfamily
1E2HA 1OSNA 1KIMA 1KI3A 4IVPA 1DBIA 1P73A 1E2JA 1KI8A 4JBXA 1II9A 4JBYA 1OF1A 1E2KA 1P7CA 3F0TA 3L02A 3KZMA 1KI4A 2KI5A 1YVEI 1YRLA 1JS1X 3FSGA 4IVQA 3FR7A 3M4JA 3RDPA 1P72A 1QMGA 1E2LA 1E2PA 1VTKA 3KZKA 2G7MC 2FG6C 3L06A 2VTKA 3KZNA 3L05A 1F48A 1YH1A 3M5CA 1LNSA 1P75A 3M5DA 1GKUB 3KZOA 3VTKA 1R4MB 1R4NB 1KI7A 1E2MA 1P6XA 1E2NA 3M4NA 3KZCA 3FR8A 1QHIA 4IVRA 3L04A 1KI2A 1KI6A 2XTJA 1E2IA 1KI6B
chains in the KnotProt database with same CATH topology
1DBIA 3KZMA 3L02A 1JS1X 3FSGA 3M4JA 3KZKA 2G7MC 2FG6C 3L06A 3KZNA 3L05A 1GKUB 3M5CA 1YH1A 1LNSA 3M5DA 3KZOA 3M4NA 3KZCA 3L04A 2XTJA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1LNS A;  3FSG A; 
#chains in the KnotProt database with same CATH topology
 1E2H A;  1OSN A;  1KIM A;  1KI3 A;  4IVP A;  1DBI A;  1P73 A;  1E2J A;  1KI8 A;  4JBX A;  1II9 A;  4JBY A;  1OF1 A;  1E2K A;  1P7C A;  3F0T A;  3L02 A;  3KZM A;  1KI4 A;  2KI5 A;  1YVE I;  1YRL A;  1JS1 X;  3FSG A;  4IVQ A;  3FR7 A;  3M4J A;  3RDP A;  1P72 A;  1QMG A;  1E2L A;  1E2P A;  1VTK A;  3KZK A;  2G7M C;  2FG6 C;  3L06 A;  2VTK A;  3KZN A;  3L05 A;  1F48 A;  1YH1 A;  3M5C A;  1LNS A;  1P75 A;  3M5D A;  1GKU B;  3KZO A;  3VTK A;  1R4M B;  1R4N B;  1KI7 A;  1E2M A;  1P6X A;  1E2N A;  3M4N A;  3KZC A;  3FR8 A;  1QHI A;  4IVR A;  3L04 A;  1KI2 A;  1KI6 A;  2XTJ A;  1E2I A;  1KI6 B; 
#chains in the KnotProt database with same CATH homology
 1DBI A;  3KZM A;  3L02 A;  1JS1 X;  3FSG A;  3M4J A;  3KZK A;  2G7M C;  2FG6 C;  3L06 A;  3KZN A;  3L05 A;  1GKU B;  3M5C A;  1YH1 A;  1LNS A;  3M5D A;  3KZO A;  3M4N A;  3KZC A;  3L04 A;  2XTJ A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling