1URTA

Murine carbonic anhydrase v
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 4-235 232 1-3, 236-237 3 2 knot
Chain Sequence
GTRQSPINIQWKDSVYDPQLAPLRVSYDAASCRYLWNTGHAFQVEFDDSCEDSGISGGPLGNHYRLKQFHFHWGATDEWGSEHAVDGHTYPAELHLVHWNSTKYENYKKASVGENGLAVIGVFLKLGAHHQALQKLVDVLPEVRHKDTQVAMGDFDPSCLMPACRDYWTYPGSLTTPPLAESVTWIVQKTPVEVSPSQLSMFRTLLFSGRGEEEDVMVNNYRPLQPLRDRKLRSSFR
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 5-235 231 1-4, 236-237 4 2 knot
sequence length 237
structure length 237
publication title Structure-based design of an intramolecular proton transfer site in murine carbonic anhydrase V.
pubmed doi rcsb
molecule tags Lyase
molecule keywords CARBONIC ANHYDRASE V
source organism Mus musculus
total genus Genus: 66
ec nomenclature ec 4.2.1.1: Carbonate dehydratase.
pdb deposition date 1996-07-03
KnotProt deposition date 2018-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Carbonic Anhydrase II 1urtA00
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1urtA00
1I8ZA 3JXHC 3MHOA 1KWRA 1BNVA 3M1JA 1A42A 1RZEA 9CA2A 1Y7WA 1CRAA 1RJ5A 1TBTX 2NN7A 1CAOA 1CAZA 1CVHA 3BETA 1BNTA 1UGFA 1Z97A 1BNNA 1CVCA 1G48A 2X7UA 1G52A 1HEAA 1T9NA 3DVDA 3IBNA 3LXEA 3CA2A 3DV7A 3IAIA 3DD8A 2O4ZA 3GZ0A 3K7KA 3KOKA 1CA3A 1YO2A 3FE4A 2FMGA 3KS3A 2Q38A 3N0NA 1BCDA 1ZSCA 2FW4A 2CBDA 1I91A 3MNIA 2NWOA 3M5TA 2NWYA 1UGBA 3DCSA 2VVAX 1G0EA 2VVBX 2NN1A 2EU3A 1BNMA 1YO1A 1HUGA 1BNWA 2W2JA 2Q1QA 1UGAA 3OKVA 1G1DA 3F7BA 3M5EA 1V9EA 1H4NA 1G4OA 3PO6A 3M2YA 3JXFA 1FQLA 1DCAA 3DVCA 1KEQA 1CA2A 3IBLA 1HCAA 1RZBA 1J9WA 2FNNA 3R16A 1CINA 3R17B 3HKUA 1V9IC 1CNGA 1H9NA 3MNKA 2OSFA 1DMYA 3ML5A 3IGPA 1CRMA 1CAYA 1XEVA 2WEOA 1CNHA 1I9PA 1HUHA 3N3JA 1UGEA 1CAKA 4CACA 3OKUA 2NNGA 1OQ5A 3IQKA 1CNIA 3CZVA 1YDAA 1THKA 1LG6A 1G45A 1RJ6A 2WEJA 1G4JA 1CAIA 3HKQA 3OIKA 1HECA 2CBAA 2GEHA 2HL4A 1LUGA 3D0NA 2HFXA 1CVDA 3EFTA 1YO0A 1IF7A 1MUAA 3DAZA 1BV3A 1IF4A 7CA2A 1CNJA 1BNQA 3OIMA 1FSRA 12CAA 3MNHA 1KWQA 3MHCA 2AW1A 2ZNCA 3N2PA 1AVNA 3P4VA 3D93A 1XPZA 2NNVA 2HFYA 1CILA 1BN3A 1AM6A 3B4FA 3M1WA 3MWOA 3MHMA 1CVFA 2FNKA 1JV0A 1CNCA 3M96A 1EOUA 3PYKA 3MHLA 3ZNCA 3MZCA 1BN1A 1FSNA 3MMFA 1I9MA 3CAJA 3IBUA 3IBIA 2HD6A 2POWA 3KWAA 1BICA 3JXGA 2NNSA 1IF5A 1F2WA 1CAHA 1FR4A 1CALA 3L14A 2NNOA 2CABA 1I9LA 3M3XA 2CBEA 1RZDA 2X7SA 1XQ0A 1G46A 3MNUA 2FNMA 3N4BA 2CBBA 2NMXA 1G6VA 1CNWA 3KIGA 3NI5A 1IF9A 3M1QA 3F4XA 2WD2A 2AX2A 1RZAA 1Z93A 1CNYA 3B1BA 3ML2A 1IF8A 3D9ZA 3DCCA 1CVBA 1HEBA 1YDBA 2CA2A 8CA2A 1XEGA 1HEDA 1DCBA 2F14A 2GD8A 1BN4A 1YDCA 3F7UA 2CBCA 2X7TA 1TG3A 1UGDA 2NXRA 3M98A 2FOSA 3DCWA 3MHIA 1ZNCA 3DBUA 1G53A 3MYQA 3HKNA 1CCTA 3NJ9A 1BNUA 2HOCA 1CVAA 2FOUA 2WD3A 1HVAA 2FMZA 1LG5A 1FQRA 1HCBA 3M67A 2NXSA 1URTA 1H9QA 1CNXA 3OILA 3MNJA 2HKKA 1I9QA 2POUA 3D92A 3DA2A 1I9NA 1CVEA 1FQMA 2IT4A 1JD0A 2H15A 1FSQA 1CANA 1LGDA 1CAMA 2ILIA 3D8WA 1OKNA 4CA2A 3C7PA 1RAYA 3BL1A 2HNCA 1BZMA 3KONA 1IF6A 3IEOA 1TH9A 3HS4A 2WEGA 3HKTA 5CACA 3MNAA 1YDDA 1RAZA 1TG9A 3HFPA 1TTMA 1KOPA 3EFIA 1CCSA 2NWPA 3DD0A 2WEHA 3KKXA 3FFPX 1FLJA 3FW3A 3MDZA 3HLJA 3K2FA 3M40A 1ZSBA 3M5SA 2HFWA 3M2ZA 3F8EA 3K34A 2POVA 1G0FA 2NXTA 3M2NA 2Q1BA 1ZE8A 1CZMA 1CCUA 6CA2A 1CIMA 1TEUX 1AZMA 3BL0A 5CA2A 3DC3A 3DVBA 2EU2A 3DC9A 1ZSAA 1KOQA 2FOQA 1LZVA 2ABEA 2NWZA 1FQNA 1I9OA 2EZ7A 1CAJA 1RZCA 1FR7A 2OSMA 1TE3X 1G3ZA 1I90A 1OKMA
chains in the KnotProt database with same CATH superfamily
1I8ZA 3JXHC 3MHOA 1KWRA 1BNVA 3M1JA 1A42A 1RZEA 9CA2A 1Y7WA 1CRAA 1RJ5A 1TBTX 2NN7A 1CAOA 1CAZA 1CVHA 3BETA 1BNTA 1UGFA 1Z97A 1BNNA 1CVCA 1G48A 2X7UA 1G52A 1HEAA 1T9NA 3DVDA 3IBNA 3LXEA 3CA2A 3DV7A 3IAIA 3DD8A 2O4ZA 3GZ0A 3K7KA 3KOKA 1CA3A 1YO2A 3FE4A 2FMGA 3KS3A 2Q38A 3N0NA 1BCDA 1ZSCA 2FW4A 2CBDA 1I91A 3MNIA 2NWOA 3M5TA 2NWYA 1UGBA 3DCSA 2VVAX 1G0EA 2VVBX 2NN1A 2EU3A 1BNMA 1YO1A 1HUGA 1BNWA 2W2JA 2Q1QA 1UGAA 3OKVA 1G1DA 3F7BA 3M5EA 1V9EA 1H4NA 1G4OA 3PO6A 3M2YA 3JXFA 1FQLA 1DCAA 3DVCA 1KEQA 1CA2A 3IBLA 1HCAA 1RZBA 1J9WA 2FNNA 3R16A 1CINA 3R17B 3HKUA 1V9IC 1CNGA 1H9NA 3MNKA 2OSFA 1DMYA 3ML5A 3IGPA 1CRMA 1CAYA 1XEVA 2WEOA 1CNHA 1I9PA 1HUHA 3N3JA 1UGEA 1CAKA 4CACA 3OKUA 2NNGA 1OQ5A 3IQKA 1CNIA 3CZVA 1YDAA 1THKA 1LG6A 1G45A 1RJ6A 2WEJA 1G4JA 1CAIA 3HKQA 3OIKA 1HECA 2CBAA 2GEHA 2HL4A 1LUGA 3D0NA 2HFXA 1CVDA 3EFTA 1YO0A 1IF7A 1MUAA 3DAZA 1BV3A 1IF4A 7CA2A 1CNJA 1BNQA 3OIMA 1FSRA 12CAA 3MNHA 1KWQA 3MHCA 2AW1A 2ZNCA 3N2PA 1AVNA 3P4VA 3D93A 1XPZA 2NNVA 2HFYA 1CILA 1BN3A 1AM6A 3B4FA 3M1WA 3MWOA 3MHMA 1CVFA 2FNKA 1JV0A 1CNCA 3M96A 1EOUA 3PYKA 3MHLA 3ZNCA 3MZCA 1BN1A 1FSNA 3MMFA 1I9MA 3CAJA 3IBUA 3IBIA 2HD6A 2POWA 3KWAA 1BICA 3JXGA 2NNSA 1IF5A 1F2WA 1CAHA 1FR4A 1CALA 3L14A 2NNOA 2CABA 1I9LA 3M3XA 2CBEA 1RZDA 2X7SA 1XQ0A 1G46A 3MNUA 2FNMA 3N4BA 2CBBA 2NMXA 1G6VA 1CNWA 3KIGA 3NI5A 1IF9A 3M1QA 3F4XA 2WD2A 2AX2A 1RZAA 1Z93A 1CNYA 3B1BA 3ML2A 1IF8A 3D9ZA 3DCCA 1CVBA 1HEBA 1YDBA 2CA2A 8CA2A 1XEGA 1HEDA 1DCBA 2F14A 2GD8A 1BN4A 1YDCA 3F7UA 2CBCA 2X7TA 1TG3A 1UGDA 2NXRA 3M98A 2FOSA 3DCWA 3MHIA 1ZNCA 3DBUA 1G53A 3MYQA 3HKNA 1CCTA 3NJ9A 1BNUA 2HOCA 1CVAA 2FOUA 2WD3A 1HVAA 2FMZA 1LG5A 1FQRA 1HCBA 3M67A 2NXSA 1URTA 1H9QA 1CNXA 3OILA 3MNJA 2HKKA 1I9QA 2POUA 3D92A 3DA2A 1I9NA 1CVEA 1FQMA 2IT4A 1JD0A 2H15A 1FSQA 1CANA 1LGDA 1CAMA 2ILIA 3D8WA 1OKNA 4CA2A 3C7PA 1RAYA 3BL1A 2HNCA 1BZMA 3KONA 1IF6A 3IEOA 1TH9A 3HS4A 2WEGA 3HKTA 5CACA 3MNAA 1YDDA 1RAZA 1TG9A 3HFPA 1TTMA 1KOPA 3EFIA 1CCSA 2NWPA 3DD0A 2WEHA 3KKXA 3FFPX 1FLJA 3FW3A 3MDZA 3HLJA 3K2FA 3M40A 1ZSBA 3M5SA 2HFWA 3M2ZA 3F8EA 3K34A 2POVA 1G0FA 2NXTA 3M2NA 2Q1BA 1ZE8A 1CZMA 1CCUA 6CA2A 1CIMA 1TEUX 1AZMA 3BL0A 5CA2A 3DC3A 3DVBA 2EU2A 3DC9A 1ZSAA 1KOQA 2FOQA 1LZVA 2ABEA 2NWZA 1FQNA 1I9OA 2EZ7A 1CAJA 1RZCA 1FR7A 2OSMA 1TE3X 1G3ZA 1I90A 1OKMA
chains in the KnotProt database with same CATH topology
1I8ZA 3JXHC 3MHOA 1KWRA 1BNVA 3M1JA 1A42A 1RZEA 9CA2A 1Y7WA 1CRAA 1RJ5A 1TBTX 2NN7A 1CAOA 1CAZA 1CVHA 3BETA 1BNTA 1UGFA 1Z97A 1BNNA 1CVCA 1G48A 2X7UA 1G52A 1HEAA 1T9NA 3DVDA 3IBNA 3LXEA 3CA2A 3DV7A 3IAIA 3DD8A 2O4ZA 3GZ0A 3K7KA 3KOKA 1CA3A 1YO2A 3FE4A 2FMGA 3KS3A 2Q38A 3N0NA 1BCDA 1ZSCA 2FW4A 2CBDA 1I91A 3MNIA 2NWOA 3M5TA 2NWYA 1UGBA 3DCSA 2VVAX 1G0EA 2VVBX 2NN1A 2EU3A 1BNMA 1YO1A 1HUGA 1BNWA 2W2JA 2Q1QA 1UGAA 3OKVA 1G1DA 3F7BA 3M5EA 1V9EA 1H4NA 1G4OA 3PO6A 3M2YA 3JXFA 1FQLA 1DCAA 3DVCA 1KEQA 1CA2A 3IBLA 1HCAA 1RZBA 1J9WA 2FNNA 3R16A 1CINA 3R17B 3HKUA 1V9IC 1CNGA 1H9NA 3MNKA 2OSFA 1DMYA 3ML5A 3IGPA 1CRMA 1CAYA 1XEVA 2WEOA 1CNHA 1I9PA 1HUHA 3N3JA 1UGEA 1CAKA 4CACA 3OKUA 2NNGA 1OQ5A 3IQKA 1CNIA 3CZVA 1YDAA 1THKA 1LG6A 1G45A 1RJ6A 2WEJA 1G4JA 1CAIA 3HKQA 3OIKA 1HECA 2CBAA 2GEHA 2HL4A 1LUGA 3D0NA 2HFXA 1CVDA 3EFTA 1YO0A 1IF7A 1MUAA 3DAZA 1BV3A 1IF4A 7CA2A 1CNJA 1BNQA 3OIMA 1FSRA 12CAA 3MNHA 1KWQA 3MHCA 2AW1A 2ZNCA 3N2PA 1AVNA 3P4VA 3D93A 1XPZA 2NNVA 2HFYA 1CILA 1BN3A 1AM6A 3B4FA 3M1WA 3MWOA 3MHMA 1CVFA 2FNKA 1JV0A 1CNCA 3M96A 1EOUA 3PYKA 3MHLA 3ZNCA 3MZCA 1BN1A 1FSNA 3MMFA 1I9MA 3CAJA 3IBUA 3IBIA 2HD6A 2POWA 3KWAA 1BICA 3JXGA 2NNSA 1IF5A 1F2WA 1CAHA 1FR4A 1CALA 3L14A 2NNOA 2CABA 1I9LA 3M3XA 2CBEA 1RZDA 2X7SA 1XQ0A 1G46A 3MNUA 2FNMA 3N4BA 2CBBA 2NMXA 1G6VA 1CNWA 3KIGA 3NI5A 1IF9A 3M1QA 3F4XA 2WD2A 2AX2A 1RZAA 1Z93A 1CNYA 3B1BA 3ML2A 1IF8A 3D9ZA 3DCCA 1CVBA 1HEBA 1YDBA 2CA2A 8CA2A 1XEGA 1HEDA 1DCBA 2F14A 2GD8A 1BN4A 1YDCA 3F7UA 2CBCA 2X7TA 1TG3A 1UGDA 2NXRA 3M98A 2FOSA 3DCWA 3MHIA 1ZNCA 3DBUA 1G53A 3MYQA 3HKNA 1CCTA 3NJ9A 1BNUA 2HOCA 1CVAA 2FOUA 2WD3A 1HVAA 2FMZA 1LG5A 1FQRA 1HCBA 3M67A 2NXSA 1URTA 1H9QA 1CNXA 3OILA 3MNJA 2HKKA 1I9QA 2POUA 3D92A 3DA2A 1I9NA 1CVEA 1FQMA 2IT4A 1JD0A 2H15A 1FSQA 1CANA 1LGDA 1CAMA 2ILIA 3D8WA 1OKNA 4CA2A 3C7PA 1RAYA 3BL1A 2HNCA 1BZMA 3KONA 1IF6A 3IEOA 1TH9A 3HS4A 2WEGA 3HKTA 5CACA 3MNAA 1YDDA 1RAZA 1TG9A 3HFPA 1TTMA 1KOPA 3EFIA 1CCSA 2NWPA 3DD0A 2WEHA 3KKXA 3FFPX 1FLJA 3FW3A 3MDZA 3HLJA 3K2FA 3M40A 1ZSBA 3M5SA 2HFWA 3M2ZA 3F8EA 3K34A 2POVA 1G0FA 2NXTA 3M2NA 2Q1BA 1ZE8A 1CZMA 1CCUA 6CA2A 1CIMA 1TEUX 1AZMA 3BL0A 5CA2A 3DC3A 3DVBA 2EU2A 3DC9A 1ZSAA 1KOQA 2FOQA 1LZVA 2ABEA 2NWZA 1FQNA 1I9OA 2EZ7A 1CAJA 1RZCA 1FR7A 2OSMA 1TE3X 1G3ZA 1I90A 1OKMA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1I8Z A;  3JXH C;  3MHO A;  1KWR A;  1BNV A;  3M1J A;  1A42 A;  1RZE A;  9CA2 A;  1Y7W A;  1CRA A;  1RJ5 A;  1TBT X;  2NN7 A;  1CAO A;  1CAZ A;  1CVH A;  3BET A;  1BNT A;  1UGF A;  1Z97 A;  1BNN A;  1CVC A;  1G48 A;  2X7U A;  1G52 A;  1HEA A;  1T9N A;  3DVD A;  3IBN A;  3LXE A;  3CA2 A;  3DV7 A;  3IAI A;  3DD8 A;  2O4Z A;  3GZ0 A;  3K7K A;  3KOK A;  1CA3 A;  1YO2 A;  3FE4 A;  2FMG A;  3KS3 A;  2Q38 A;  3N0N A;  1BCD A;  1ZSC A;  2FW4 A;  2CBD A;  1I91 A;  3MNI A;  2NWO A;  3M5T A;  2NWY A;  1UGB A;  3DCS A;  2VVA X;  1G0E A;  2VVB X;  2NN1 A;  2EU3 A;  1BNM A;  1YO1 A;  1HUG A;  1BNW A;  2W2J A;  2Q1Q A;  1UGA A;  3OKV A;  1G1D A;  3F7B A;  3M5E A;  1V9E A;  1H4N A;  1G4O A;  3PO6 A;  3M2Y A;  3JXF A;  1FQL A;  1DCA A;  3DVC A;  1KEQ A;  1CA2 A;  3IBL A;  1HCA A;  1RZB A;  1J9W A;  2FNN A;  3R16 A;  1CIN A;  3R17 B;  3HKU A;  1V9I C;  1CNG A;  1H9N A;  3MNK A;  2OSF A;  1DMY A;  3ML5 A;  3IGP A;  1CRM A;  1CAY A;  1XEV A;  2WEO A;  1CNH A;  1I9P A;  1HUH A;  3N3J A;  1UGE A;  1CAK A;  4CAC A;  3OKU A;  2NNG A;  1OQ5 A;  3IQK A;  1CNI A;  3CZV A;  1YDA A;  1THK A;  1LG6 A;  1G45 A;  1RJ6 A;  2WEJ A;  1G4J A;  1CAI A;  3HKQ A;  3OIK A;  1HEC A;  2CBA A;  2GEH A;  2HL4 A;  1LUG A;  3D0N A;  2HFX A;  1CVD A;  3EFT A;  1YO0 A;  1IF7 A;  1MUA A;  3DAZ A;  1BV3 A;  1IF4 A;  7CA2 A;  1CNJ A;  1BNQ A;  3OIM A;  1FSR A;  12CA A;  3MNH A;  1KWQ A;  3MHC A;  2AW1 A;  2ZNC A;  3N2P A;  1AVN A;  3P4V A;  3D93 A;  1XPZ A;  2NNV A;  2HFY A;  1CIL A;  1BN3 A;  1AM6 A;  3B4F A;  3M1W A;  3MWO A;  3MHM A;  1CVF A;  2FNK A;  1JV0 A;  1CNC A;  3M96 A;  1EOU A;  3PYK A;  3MHL A;  3ZNC A;  3MZC A;  1BN1 A;  1FSN A;  3MMF A;  1I9M A;  3CAJ A;  3IBU A;  3IBI A;  2HD6 A;  2POW A;  3KWA A;  1BIC A;  3JXG A;  2NNS A;  1IF5 A;  1F2W A;  1CAH A;  1FR4 A;  1CAL A;  3L14 A;  2NNO A;  2CAB A;  1I9L A;  3M3X A;  2CBE A;  1RZD A;  2X7S A;  1XQ0 A;  1G46 A;  3MNU A;  2FNM A;  3N4B A;  2CBB A;  2NMX A;  1G6V A;  1CNW A;  3KIG A;  3NI5 A;  1IF9 A;  3M1Q A;  3F4X A;  2WD2 A;  2AX2 A;  1RZA A;  1Z93 A;  1CNY A;  3B1B A;  3ML2 A;  1IF8 A;  3D9Z A;  3DCC A;  1CVB A;  1HEB A;  1YDB A;  2CA2 A;  8CA2 A;  1XEG A;  1HED A;  1DCB A;  2F14 A;  2GD8 A;  1BN4 A;  1YDC A;  3F7U A;  2CBC A;  2X7T A;  1TG3 A;  1UGD A;  2NXR A;  3M98 A;  2FOS A;  3DCW A;  3MHI A;  1ZNC A;  3DBU A;  1G53 A;  3MYQ A;  3HKN A;  1CCT A;  3NJ9 A;  1BNU A;  2HOC A;  1CVA A;  2FOU A;  2WD3 A;  1HVA A;  2FMZ A;  1LG5 A;  1FQR A;  1HCB A;  3M67 A;  2NXS A;  1URT A;  1H9Q A;  1CNX A;  3OIL A;  3MNJ A;  2HKK A;  1I9Q A;  2POU A;  3D92 A;  3DA2 A;  1I9N A;  1CVE A;  1FQM A;  2IT4 A;  1JD0 A;  2H15 A;  1FSQ A;  1CAN A;  1LGD A;  1CAM A;  2ILI A;  3D8W A;  1OKN A;  4CA2 A;  3C7P A;  1RAY A;  3BL1 A;  2HNC A;  1BZM A;  3KON A;  1IF6 A;  3IEO A;  1TH9 A;  3HS4 A;  2WEG A;  3HKT A;  5CAC A;  3MNA A;  1YDD A;  1RAZ A;  1TG9 A;  3HFP A;  1TTM A;  1KOP A;  3EFI A;  1CCS A;  2NWP A;  3DD0 A;  2WEH A;  3KKX A;  3FFP X;  1FLJ A;  3FW3 A;  3MDZ A;  3HLJ A;  3K2F A;  3M40 A;  1ZSB A;  3M5S A;  2HFW A;  3M2Z A;  3F8E A;  3K34 A;  2POV A;  1G0F A;  2NXT A;  3M2N A;  2Q1B A;  1ZE8 A;  1CZM A;  1CCU A;  6CA2 A;  1CIM A;  1TEU X;  1AZM A;  3BL0 A;  5CA2 A;  3DC3 A;  3DVB A;  2EU2 A;  3DC9 A;  1ZSA A;  1KOQ A;  2FOQ A;  1LZV A;  2ABE A;  2NWZ A;  1FQN A;  1I9O A;  2EZ7 A;  1CAJ A;  1RZC A;  1FR7 A;  2OSM A;  1TE3 X;  1G3Z A;  1I90 A;  1OKM A; 
#chains in the KnotProt database with same CATH topology
 1I8Z A;  3JXH C;  3MHO A;  1KWR A;  1BNV A;  3M1J A;  1A42 A;  1RZE A;  9CA2 A;  1Y7W A;  1CRA A;  1RJ5 A;  1TBT X;  2NN7 A;  1CAO A;  1CAZ A;  1CVH A;  3BET A;  1BNT A;  1UGF A;  1Z97 A;  1BNN A;  1CVC A;  1G48 A;  2X7U A;  1G52 A;  1HEA A;  1T9N A;  3DVD A;  3IBN A;  3LXE A;  3CA2 A;  3DV7 A;  3IAI A;  3DD8 A;  2O4Z A;  3GZ0 A;  3K7K A;  3KOK A;  1CA3 A;  1YO2 A;  3FE4 A;  2FMG A;  3KS3 A;  2Q38 A;  3N0N A;  1BCD A;  1ZSC A;  2FW4 A;  2CBD A;  1I91 A;  3MNI A;  2NWO A;  3M5T A;  2NWY A;  1UGB A;  3DCS A;  2VVA X;  1G0E A;  2VVB X;  2NN1 A;  2EU3 A;  1BNM A;  1YO1 A;  1HUG A;  1BNW A;  2W2J A;  2Q1Q A;  1UGA A;  3OKV A;  1G1D A;  3F7B A;  3M5E A;  1V9E A;  1H4N A;  1G4O A;  3PO6 A;  3M2Y A;  3JXF A;  1FQL A;  1DCA A;  3DVC A;  1KEQ A;  1CA2 A;  3IBL A;  1HCA A;  1RZB A;  1J9W A;  2FNN A;  3R16 A;  1CIN A;  3R17 B;  3HKU A;  1V9I C;  1CNG A;  1H9N A;  3MNK A;  2OSF A;  1DMY A;  3ML5 A;  3IGP A;  1CRM A;  1CAY A;  1XEV A;  2WEO A;  1CNH A;  1I9P A;  1HUH A;  3N3J A;  1UGE A;  1CAK A;  4CAC A;  3OKU A;  2NNG A;  1OQ5 A;  3IQK A;  1CNI A;  3CZV A;  1YDA A;  1THK A;  1LG6 A;  1G45 A;  1RJ6 A;  2WEJ A;  1G4J A;  1CAI A;  3HKQ A;  3OIK A;  1HEC A;  2CBA A;  2GEH A;  2HL4 A;  1LUG A;  3D0N A;  2HFX A;  1CVD A;  3EFT A;  1YO0 A;  1IF7 A;  1MUA A;  3DAZ A;  1BV3 A;  1IF4 A;  7CA2 A;  1CNJ A;  1BNQ A;  3OIM A;  1FSR A;  12CA A;  3MNH A;  1KWQ A;  3MHC A;  2AW1 A;  2ZNC A;  3N2P A;  1AVN A;  3P4V A;  3D93 A;  1XPZ A;  2NNV A;  2HFY A;  1CIL A;  1BN3 A;  1AM6 A;  3B4F A;  3M1W A;  3MWO A;  3MHM A;  1CVF A;  2FNK A;  1JV0 A;  1CNC A;  3M96 A;  1EOU A;  3PYK A;  3MHL A;  3ZNC A;  3MZC A;  1BN1 A;  1FSN A;  3MMF A;  1I9M A;  3CAJ A;  3IBU A;  3IBI A;  2HD6 A;  2POW A;  3KWA A;  1BIC A;  3JXG A;  2NNS A;  1IF5 A;  1F2W A;  1CAH A;  1FR4 A;  1CAL A;  3L14 A;  2NNO A;  2CAB A;  1I9L A;  3M3X A;  2CBE A;  1RZD A;  2X7S A;  1XQ0 A;  1G46 A;  3MNU A;  2FNM A;  3N4B A;  2CBB A;  2NMX A;  1G6V A;  1CNW A;  3KIG A;  3NI5 A;  1IF9 A;  3M1Q A;  3F4X A;  2WD2 A;  2AX2 A;  1RZA A;  1Z93 A;  1CNY A;  3B1B A;  3ML2 A;  1IF8 A;  3D9Z A;  3DCC A;  1CVB A;  1HEB A;  1YDB A;  2CA2 A;  8CA2 A;  1XEG A;  1HED A;  1DCB A;  2F14 A;  2GD8 A;  1BN4 A;  1YDC A;  3F7U A;  2CBC A;  2X7T A;  1TG3 A;  1UGD A;  2NXR A;  3M98 A;  2FOS A;  3DCW A;  3MHI A;  1ZNC A;  3DBU A;  1G53 A;  3MYQ A;  3HKN A;  1CCT A;  3NJ9 A;  1BNU A;  2HOC A;  1CVA A;  2FOU A;  2WD3 A;  1HVA A;  2FMZ A;  1LG5 A;  1FQR A;  1HCB A;  3M67 A;  2NXS A;  1URT A;  1H9Q A;  1CNX A;  3OIL A;  3MNJ A;  2HKK A;  1I9Q A;  2POU A;  3D92 A;  3DA2 A;  1I9N A;  1CVE A;  1FQM A;  2IT4 A;  1JD0 A;  2H15 A;  1FSQ A;  1CAN A;  1LGD A;  1CAM A;  2ILI A;  3D8W A;  1OKN A;  4CA2 A;  3C7P A;  1RAY A;  3BL1 A;  2HNC A;  1BZM A;  3KON A;  1IF6 A;  3IEO A;  1TH9 A;  3HS4 A;  2WEG A;  3HKT A;  5CAC A;  3MNA A;  1YDD A;  1RAZ A;  1TG9 A;  3HFP A;  1TTM A;  1KOP A;  3EFI A;  1CCS A;  2NWP A;  3DD0 A;  2WEH A;  3KKX A;  3FFP X;  1FLJ A;  3FW3 A;  3MDZ A;  3HLJ A;  3K2F A;  3M40 A;  1ZSB A;  3M5S A;  2HFW A;  3M2Z A;  3F8E A;  3K34 A;  2POV A;  1G0F A;  2NXT A;  3M2N A;  2Q1B A;  1ZE8 A;  1CZM A;  1CCU A;  6CA2 A;  1CIM A;  1TEU X;  1AZM A;  3BL0 A;  5CA2 A;  3DC3 A;  3DVB A;  2EU2 A;  3DC9 A;  1ZSA A;  1KOQ A;  2FOQ A;  1LZV A;  2ABE A;  2NWZ A;  1FQN A;  1I9O A;  2EZ7 A;  1CAJ A;  1RZC A;  1FR7 A;  2OSM A;  1TE3 X;  1G3Z A;  1I90 A;  1OKM A; 
#chains in the KnotProt database with same CATH homology
 1I8Z A;  3JXH C;  3MHO A;  1KWR A;  1BNV A;  3M1J A;  1A42 A;  1RZE A;  9CA2 A;  1Y7W A;  1CRA A;  1RJ5 A;  1TBT X;  2NN7 A;  1CAO A;  1CAZ A;  1CVH A;  3BET A;  1BNT A;  1UGF A;  1Z97 A;  1BNN A;  1CVC A;  1G48 A;  2X7U A;  1G52 A;  1HEA A;  1T9N A;  3DVD A;  3IBN A;  3LXE A;  3CA2 A;  3DV7 A;  3IAI A;  3DD8 A;  2O4Z A;  3GZ0 A;  3K7K A;  3KOK A;  1CA3 A;  1YO2 A;  3FE4 A;  2FMG A;  3KS3 A;  2Q38 A;  3N0N A;  1BCD A;  1ZSC A;  2FW4 A;  2CBD A;  1I91 A;  3MNI A;  2NWO A;  3M5T A;  2NWY A;  1UGB A;  3DCS A;  2VVA X;  1G0E A;  2VVB X;  2NN1 A;  2EU3 A;  1BNM A;  1YO1 A;  1HUG A;  1BNW A;  2W2J A;  2Q1Q A;  1UGA A;  3OKV A;  1G1D A;  3F7B A;  3M5E A;  1V9E A;  1H4N A;  1G4O A;  3PO6 A;  3M2Y A;  3JXF A;  1FQL A;  1DCA A;  3DVC A;  1KEQ A;  1CA2 A;  3IBL A;  1HCA A;  1RZB A;  1J9W A;  2FNN A;  3R16 A;  1CIN A;  3R17 B;  3HKU A;  1V9I C;  1CNG A;  1H9N A;  3MNK A;  2OSF A;  1DMY A;  3ML5 A;  3IGP A;  1CRM A;  1CAY A;  1XEV A;  2WEO A;  1CNH A;  1I9P A;  1HUH A;  3N3J A;  1UGE A;  1CAK A;  4CAC A;  3OKU A;  2NNG A;  1OQ5 A;  3IQK A;  1CNI A;  3CZV A;  1YDA A;  1THK A;  1LG6 A;  1G45 A;  1RJ6 A;  2WEJ A;  1G4J A;  1CAI A;  3HKQ A;  3OIK A;  1HEC A;  2CBA A;  2GEH A;  2HL4 A;  1LUG A;  3D0N A;  2HFX A;  1CVD A;  3EFT A;  1YO0 A;  1IF7 A;  1MUA A;  3DAZ A;  1BV3 A;  1IF4 A;  7CA2 A;  1CNJ A;  1BNQ A;  3OIM A;  1FSR A;  12CA A;  3MNH A;  1KWQ A;  3MHC A;  2AW1 A;  2ZNC A;  3N2P A;  1AVN A;  3P4V A;  3D93 A;  1XPZ A;  2NNV A;  2HFY A;  1CIL A;  1BN3 A;  1AM6 A;  3B4F A;  3M1W A;  3MWO A;  3MHM A;  1CVF A;  2FNK A;  1JV0 A;  1CNC A;  3M96 A;  1EOU A;  3PYK A;  3MHL A;  3ZNC A;  3MZC A;  1BN1 A;  1FSN A;  3MMF A;  1I9M A;  3CAJ A;  3IBU A;  3IBI A;  2HD6 A;  2POW A;  3KWA A;  1BIC A;  3JXG A;  2NNS A;  1IF5 A;  1F2W A;  1CAH A;  1FR4 A;  1CAL A;  3L14 A;  2NNO A;  2CAB A;  1I9L A;  3M3X A;  2CBE A;  1RZD A;  2X7S A;  1XQ0 A;  1G46 A;  3MNU A;  2FNM A;  3N4B A;  2CBB A;  2NMX A;  1G6V A;  1CNW A;  3KIG A;  3NI5 A;  1IF9 A;  3M1Q A;  3F4X A;  2WD2 A;  2AX2 A;  1RZA A;  1Z93 A;  1CNY A;  3B1B A;  3ML2 A;  1IF8 A;  3D9Z A;  3DCC A;  1CVB A;  1HEB A;  1YDB A;  2CA2 A;  8CA2 A;  1XEG A;  1HED A;  1DCB A;  2F14 A;  2GD8 A;  1BN4 A;  1YDC A;  3F7U A;  2CBC A;  2X7T A;  1TG3 A;  1UGD A;  2NXR A;  3M98 A;  2FOS A;  3DCW A;  3MHI A;  1ZNC A;  3DBU A;  1G53 A;  3MYQ A;  3HKN A;  1CCT A;  3NJ9 A;  1BNU A;  2HOC A;  1CVA A;  2FOU A;  2WD3 A;  1HVA A;  2FMZ A;  1LG5 A;  1FQR A;  1HCB A;  3M67 A;  2NXS A;  1URT A;  1H9Q A;  1CNX A;  3OIL A;  3MNJ A;  2HKK A;  1I9Q A;  2POU A;  3D92 A;  3DA2 A;  1I9N A;  1CVE A;  1FQM A;  2IT4 A;  1JD0 A;  2H15 A;  1FSQ A;  1CAN A;  1LGD A;  1CAM A;  2ILI A;  3D8W A;  1OKN A;  4CA2 A;  3C7P A;  1RAY A;  3BL1 A;  2HNC A;  1BZM A;  3KON A;  1IF6 A;  3IEO A;  1TH9 A;  3HS4 A;  2WEG A;  3HKT A;  5CAC A;  3MNA A;  1YDD A;  1RAZ A;  1TG9 A;  3HFP A;  1TTM A;  1KOP A;  3EFI A;  1CCS A;  2NWP A;  3DD0 A;  2WEH A;  3KKX A;  3FFP X;  1FLJ A;  3FW3 A;  3MDZ A;  3HLJ A;  3K2F A;  3M40 A;  1ZSB A;  3M5S A;  2HFW A;  3M2Z A;  3F8E A;  3K34 A;  2POV A;  1G0F A;  2NXT A;  3M2N A;  2Q1B A;  1ZE8 A;  1CZM A;  1CCU A;  6CA2 A;  1CIM A;  1TEU X;  1AZM A;  3BL0 A;  5CA2 A;  3DC3 A;  3DVB A;  2EU2 A;  3DC9 A;  1ZSA A;  1KOQ A;  2FOQ A;  1LZV A;  2ABE A;  2NWZ A;  1FQN A;  1I9O A;  2EZ7 A;  1CAJ A;  1RZC A;  1FR7 A;  2OSM A;  1TE3 X;  1G3Z A;  1I90 A;  1OKM A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling