3M5SA

Carbonic anhydrase ii mutant h64c in complex with carbonate
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 16-256 241 257-258 1-3 4-15 3 1 slipknot
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGCAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 3x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 13-256 244 257-258 1-1 2-12 1 1 slipknot
Fingerprint Knot forming loop Loop type
K +31
Chain closureHis3 <-> Phe260
... His96 <->
Bridging ionZn500
<-> His94 ... His3
probabilistic
K +31 His3 ... His96 <->
Bridging ionZn500
<-> His119 ...
Chain closurePhe260 <-> His3
probabilistic
K +31 His3 ... His94 <->
Bridging ionZn500
<-> His119 ...
Chain closurePhe260 <-> His3
probabilistic
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGCAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 25-253 229 1-24, 254-257 24 4 knot
sequence length 257
structure length 257
publication title Mutational study on Carbonic Anhydrase II
rcsb
molecule tags Lyase
molecule keywords Carbonic anhydrase 2
source organism Homo sapiens
total genus Genus: 79
ec nomenclature ec 4.2.1.1: Carbonate dehydratase.
pdb deposition date 2010-03-13
KnotProt deposition date 2018-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Carbonic Anhydrase II 3m5sA00
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Carbonic Anhydrase II 3m5sA00
2NXSA 3DC9A 1I9QA 3F8EA 3MHMA 2NN7A 1RZDA 3DA2A 1CAZA 3MNHA 1CVDA 1MUAA 2CBDA 2H15A 3KONA 3IQKA 1YO2A 2IT4A 1G53A 7CA2A 5CACA 1CAYA 3NJ9A 1CVCA 1I9LA 1TEUX 1LUGA 2Q1BA 1BN4A 1CNGA 3M2NA 9CA2A 3MHOA 1V9IC 3R17B 2NXRA 3D93A 1I9NA 3IAIA 1RZAA 2POVA 3M1WA 2NMXA 1G4JA 1BNNA 3HS4A 1HVAA 1CALA 3PO6A 3IBUA 1CANA 1V9EA 2W2JA 3M1JA 1TH9A 2HFWA 3M3XA 1TG9A 1EOUA 1H4NA 1FR7A 1AM6A 1YO0A 3M2YA 1FQMA 1UGEA 3N0NA 1TBTX 3M67A 2AX2A 1CA2A 1HUHA 2NWPA 3CA2A 3MWOA 2Q1QA 2ILIA 3DCCA 2HFYA 3DVDA 1DCBA 2NXTA 1G46A 1LGDA 1G52A 3IGPA 1DMYA 1ZNCA 2X7UA 2FNKA 1FSNA 3KS3A 3ML5A 1RJ6A 3DCSA 2OSFA 2NNVA 2FNNA 1FQLA 1CVBA 1IF8A 1KWQA 3MNKA 2NN1A 2F14A 1YDDA 3P4VA 1TE3X 8CA2A 1ZE8A 3DCWA 2EU3A 2X7TA 1KOPA 4CACA 1CAMA 1G0FA 1CCTA 1ZSCA 3B1BA 2CBCA 1UGBA 2VVAX 3M40A 1CVAA 1IF7A 2ZNCA 1FSRA 2Q38A 2WD2A 1BN1A 3EFTA 1OQ5A 1I9MA 1CVFA 1XEVA 1AVNA 3DD0A 1CAIA 1XPZA 3R16A 3IBNA 3BETA 1CAHA 3BL1A 1H9NA 3OILA 3M5TA 2FNMA 1RAZA 2ABEA 1XEGA 2HL4A 3FW3A 2VVBX 1HECA 2X7SA 3DC3A 1G6VA 2HOCA 3KKXA 1BNQA 3M1QA 1ZSAA 1LZVA 3NI5A 1Y7WA 3OIMA 2WD3A 1BNMA 1CA3A 3MNUA 3FE4A 3M5SA 2FW4A 1IF6A 1FQNA 3D8WA 1CVEA 1ZSBA 1Z93A 3M98A 1I90A 1KWRA 1HEBA 2OSMA 2HNCA 3ZNCA 1JV0A 2HD6A 1BICA 2CBAA 3OKVA 1BNUA 1RAYA 1BN3A 2FOUA 3C7PA 2FMGA 3F4XA 1CNYA 1CNIA 3KIGA 1THKA 3BL0A 2POWA 3HKNA 3DD8A 1T9NA 3D92A 3M96A 3HKQA 1HUGA 1Z97A 2WEOA 1OKMA 1CNWA 1LG6A 1YDCA 3MHIA 2NNSA 2NNOA 1CNCA 1CCSA 3DV7A 3K2FA 1G45A 1G1DA 4PYYA 2HKKA 2HFXA 2NWYA 1I9PA 2WEJA 3KOKA 1I91A 1LG5A 1TTMA 1TG3A 3ML2A 1BV3A 3CZVA 1YDAA 1KOQA 1RZBA 2NWZA 3IBIA 2CBBA 3OKUA 2CBEA 3L14A 1CRMA 1G4OA 1UGAA 1CZMA 3MHLA 1DCAA 3HKTA 1BNVA 1CIMA 2NWOA 2O4ZA 3D0NA 1CAKA 1CRAA 2FOSA 3OIKA 3GZ0A 1URTA 1HCBA 1IF4A 3MHCA 3M2ZA 1CCUA 5CA2A 3MNJA 1IF5A 1FQRA 3JXHC 1FSQA 2WEGA 1CVHA 3N2PA 2CA2A 3MNIA 3MZCA 1I8ZA 2POUA 1AZMA 1CAOA 1YDBA 1H9QA 1YO1A 2EU2A 3HLJA 1JD0A 3EFIA 3B4FA 3HFPA 1FR4A 1BNWA 3LXEA 3N4BA 1CILA 3DVBA 2EZ7A 2AW1A 1F2WA 1UGFA 1CINA 1UGDA 1CNJA 1HCAA 2WEHA 1FLJA 3JXFA 6CA2A 3FFPX 1HEDA 3MYQA 1CNHA 2FOQA 2GEHA 1BNTA 1A42A 1G48A 1G0EA 1BCDA 2NNGA 3MDZA 3DBUA 3PYKA 1RZEA 3DVCA 2GD8A 3IEOA 1CAJA 3KWAA 1RJ5A 3MMFA 1I9OA 1CNXA 3F7BA 12CAA 1IF9A 3MNAA 1RZCA 3F7UA 3K7KA 2CABA 3HKUA 1BZMA 3JXGA 3M5EA 1XQ0A 4CA2A 3K34A 3D9ZA 1OKNA 1G3ZA 1HEAA 3CAJA 1J9WA 3N3JA 1KEQA 3IBLA 3DAZA 2FMZA
chains in the KnotProt database with same CATH superfamily
2NXSA 3DC9A 1I9QA 3F8EA 3MHMA 2NN7A 1RZDA 3DA2A 1CAZA 3MNHA 1CVDA 1MUAA 2CBDA 2H15A 3KONA 3IQKA 1YO2A 2IT4A 1G53A 7CA2A 5CACA 1CAYA 3NJ9A 1CVCA 1I9LA 1TEUX 1LUGA 2Q1BA 1BN4A 1CNGA 3M2NA 9CA2A 3MHOA 1V9IC 3R17B 2NXRA 3D93A 1I9NA 3IAIA 1RZAA 2POVA 3M1WA 2NMXA 1G4JA 1BNNA 3HS4A 1HVAA 1CALA 3PO6A 3IBUA 1CANA 1V9EA 2W2JA 3M1JA 1TH9A 2HFWA 3M3XA 1TG9A 1EOUA 1H4NA 1FR7A 1AM6A 1YO0A 3M2YA 1FQMA 1UGEA 3N0NA 1TBTX 3M67A 2AX2A 1CA2A 1HUHA 2NWPA 3CA2A 3MWOA 2Q1QA 2ILIA 3DCCA 2HFYA 3DVDA 1DCBA 2NXTA 1G46A 1LGDA 1G52A 3IGPA 1DMYA 1ZNCA 2X7UA 2FNKA 1FSNA 3KS3A 3ML5A 1RJ6A 3DCSA 2OSFA 2NNVA 2FNNA 1FQLA 1CVBA 1IF8A 1KWQA 3MNKA 2NN1A 2F14A 1YDDA 3P4VA 1TE3X 8CA2A 1ZE8A 3DCWA 2EU3A 2X7TA 1KOPA 4CACA 1CAMA 1G0FA 1CCTA 1ZSCA 3B1BA 2CBCA 1UGBA 2VVAX 3M40A 1CVAA 1IF7A 2ZNCA 1FSRA 2Q38A 2WD2A 1BN1A 3EFTA 1OQ5A 1I9MA 1CVFA 1XEVA 1AVNA 3DD0A 1CAIA 1XPZA 3R16A 3IBNA 3BETA 1CAHA 3BL1A 1H9NA 3OILA 3M5TA 2FNMA 1RAZA 2ABEA 1XEGA 2HL4A 3FW3A 2VVBX 1HECA 2X7SA 3DC3A 1G6VA 2HOCA 3KKXA 1BNQA 3M1QA 1ZSAA 1LZVA 3NI5A 1Y7WA 3OIMA 2WD3A 1BNMA 1CA3A 3MNUA 3FE4A 3M5SA 2FW4A 1IF6A 1FQNA 3D8WA 1CVEA 1ZSBA 1Z93A 3M98A 1I90A 1KWRA 1HEBA 2OSMA 2HNCA 3ZNCA 1JV0A 2HD6A 1BICA 2CBAA 3OKVA 1BNUA 1RAYA 1BN3A 2FOUA 3C7PA 2FMGA 3F4XA 1CNYA 1CNIA 3KIGA 1THKA 3BL0A 2POWA 3HKNA 3DD8A 1T9NA 3D92A 3M96A 3HKQA 1HUGA 1Z97A 2WEOA 1OKMA 1CNWA 1LG6A 1YDCA 3MHIA 2NNSA 2NNOA 1CNCA 1CCSA 3DV7A 3K2FA 1G45A 1G1DA 4PYYA 2HKKA 2HFXA 2NWYA 1I9PA 2WEJA 3KOKA 1I91A 1LG5A 1TTMA 1TG3A 3ML2A 1BV3A 3CZVA 1YDAA 1KOQA 1RZBA 2NWZA 3IBIA 2CBBA 3OKUA 2CBEA 3L14A 1CRMA 1G4OA 1UGAA 1CZMA 3MHLA 1DCAA 3HKTA 1BNVA 1CIMA 2NWOA 2O4ZA 3D0NA 1CAKA 1CRAA 2FOSA 3OIKA 3GZ0A 1URTA 1HCBA 1IF4A 3MHCA 3M2ZA 1CCUA 5CA2A 3MNJA 1IF5A 1FQRA 3JXHC 1FSQA 2WEGA 1CVHA 3N2PA 2CA2A 3MNIA 3MZCA 1I8ZA 2POUA 1AZMA 1CAOA 1YDBA 1H9QA 1YO1A 2EU2A 3HLJA 1JD0A 3EFIA 3B4FA 3HFPA 1FR4A 1BNWA 3LXEA 3N4BA 1CILA 3DVBA 2EZ7A 2AW1A 1F2WA 1UGFA 1CINA 1UGDA 1CNJA 1HCAA 2WEHA 1FLJA 3JXFA 6CA2A 3FFPX 1HEDA 3MYQA 1CNHA 2FOQA 2GEHA 1BNTA 1A42A 1G48A 1G0EA 1BCDA 2NNGA 3MDZA 3DBUA 3PYKA 1RZEA 3DVCA 2GD8A 3IEOA 1CAJA 3KWAA 1RJ5A 3MMFA 1I9OA 1CNXA 3F7BA 12CAA 1IF9A 3MNAA 1RZCA 3F7UA 3K7KA 2CABA 3HKUA 1BZMA 3JXGA 3M5EA 1XQ0A 4CA2A 3K34A 3D9ZA 1OKNA 1G3ZA 1HEAA 3CAJA 1J9WA 3N3JA 1KEQA 3IBLA 3DAZA 2FMZA
chains in the KnotProt database with same CATH topology
2NXSA 3DC9A 1I9QA 3F8EA 3MHMA 2NN7A 1RZDA 3DA2A 1CAZA 3MNHA 1CVDA 1MUAA 2CBDA 2H15A 3KONA 3IQKA 1YO2A 2IT4A 1G53A 7CA2A 5CACA 1CAYA 3NJ9A 1CVCA 1I9LA 1TEUX 1LUGA 2Q1BA 1BN4A 1CNGA 3M2NA 9CA2A 3MHOA 1V9IC 3R17B 2NXRA 3D93A 1I9NA 3IAIA 1RZAA 2POVA 3M1WA 2NMXA 1G4JA 1BNNA 3HS4A 1HVAA 1CALA 3PO6A 3IBUA 1CANA 1V9EA 2W2JA 3M1JA 1TH9A 2HFWA 3M3XA 1TG9A 1EOUA 1H4NA 1FR7A 1AM6A 1YO0A 3M2YA 1FQMA 1UGEA 3N0NA 1TBTX 3M67A 2AX2A 1CA2A 1HUHA 2NWPA 3CA2A 3MWOA 2Q1QA 2ILIA 3DCCA 2HFYA 3DVDA 1DCBA 2NXTA 1G46A 1LGDA 1G52A 3IGPA 1DMYA 1ZNCA 2X7UA 2FNKA 1FSNA 3KS3A 3ML5A 1RJ6A 3DCSA 2OSFA 2NNVA 2FNNA 1FQLA 1CVBA 1IF8A 1KWQA 3MNKA 2NN1A 2F14A 1YDDA 3P4VA 1TE3X 8CA2A 1ZE8A 3DCWA 2EU3A 2X7TA 1KOPA 4CACA 1CAMA 1G0FA 1CCTA 1ZSCA 3B1BA 2CBCA 1UGBA 2VVAX 3M40A 1CVAA 1IF7A 2ZNCA 1FSRA 2Q38A 2WD2A 1BN1A 3EFTA 1OQ5A 1I9MA 1CVFA 1XEVA 1AVNA 3DD0A 1CAIA 1XPZA 3R16A 3IBNA 3BETA 1CAHA 3BL1A 1H9NA 3OILA 3M5TA 2FNMA 1RAZA 2ABEA 1XEGA 2HL4A 3FW3A 2VVBX 1HECA 2X7SA 3DC3A 1G6VA 2HOCA 3KKXA 1BNQA 3M1QA 1ZSAA 1LZVA 3NI5A 1Y7WA 3OIMA 2WD3A 1BNMA 1CA3A 3MNUA 3FE4A 3M5SA 2FW4A 1IF6A 1FQNA 3D8WA 1CVEA 1ZSBA 1Z93A 3M98A 1I90A 1KWRA 1HEBA 2OSMA 2HNCA 3ZNCA 1JV0A 2HD6A 1BICA 2CBAA 3OKVA 1BNUA 1RAYA 1BN3A 2FOUA 3C7PA 2FMGA 3F4XA 1CNYA 1CNIA 3KIGA 1THKA 3BL0A 2POWA 3HKNA 3DD8A 1T9NA 3D92A 3M96A 3HKQA 1HUGA 1Z97A 2WEOA 1OKMA 1CNWA 1LG6A 1YDCA 3MHIA 2NNSA 2NNOA 1CNCA 1CCSA 3DV7A 3K2FA 1G45A 1G1DA 2HKKA 2HFXA 2NWYA 1I9PA 2WEJA 3KOKA 1I91A 1LG5A 1TTMA 1TG3A 3ML2A 1BV3A 3CZVA 1YDAA 1KOQA 1RZBA 2NWZA 3IBIA 2CBBA 3OKUA 2CBEA 3L14A 1CRMA 1G4OA 1UGAA 1CZMA 3MHLA 1DCAA 3HKTA 1BNVA 1CIMA 2NWOA 2O4ZA 3D0NA 1CAKA 1CRAA 2FOSA 3OIKA 3GZ0A 1URTA 1HCBA 1IF4A 3MHCA 3M2ZA 1CCUA 5CA2A 3MNJA 1IF5A 1FQRA 3JXHC 1FSQA 2WEGA 1CVHA 3N2PA 2CA2A 3MNIA 3MZCA 1I8ZA 2POUA 1AZMA 1CAOA 1YDBA 1H9QA 1YO1A 2EU2A 3HLJA 1JD0A 3EFIA 3B4FA 3HFPA 1FR4A 1BNWA 3LXEA 3N4BA 1CILA 3DVBA 2EZ7A 2AW1A 1F2WA 1UGFA 1CINA 1UGDA 1CNJA 1HCAA 2WEHA 1FLJA 3JXFA 6CA2A 3FFPX 1HEDA 3MYQA 1CNHA 2FOQA 2GEHA 1BNTA 1A42A 1G48A 1G0EA 1BCDA 2NNGA 3MDZA 3DBUA 3PYKA 1RZEA 3DVCA 2GD8A 3IEOA 1CAJA 3KWAA 1RJ5A 3MMFA 1I9OA 1CNXA 3F7BA 12CAA 1IF9A 3MNAA 1RZCA 3F7UA 3K7KA 2CABA 3HKUA 1BZMA 3JXGA 3M5EA 1XQ0A 4CA2A 3K34A 3D9ZA 1OKNA 1G3ZA 1HEAA 3CAJA 1J9WA 3N3JA 1KEQA 3IBLA 3DAZA 2FMZA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2NXS A;  3DC9 A;  1I9Q A;  3F8E A;  3MHM A;  2NN7 A;  1RZD A;  3DA2 A;  1CAZ A;  3MNH A;  1CVD A;  1MUA A;  2CBD A;  2H15 A;  3KON A;  3IQK A;  1YO2 A;  2IT4 A;  1G53 A;  7CA2 A;  5CAC A;  1CAY A;  3NJ9 A;  1CVC A;  1I9L A;  1TEU X;  1LUG A;  2Q1B A;  1BN4 A;  1CNG A;  3M2N A;  9CA2 A;  3MHO A;  1V9I C;  3R17 B;  2NXR A;  3D93 A;  1I9N A;  3IAI A;  1RZA A;  2POV A;  3M1W A;  2NMX A;  1G4J A;  1BNN A;  3HS4 A;  1HVA A;  1CAL A;  3PO6 A;  3IBU A;  1CAN A;  1V9E A;  2W2J A;  3M1J A;  1TH9 A;  2HFW A;  3M3X A;  1TG9 A;  1EOU A;  1H4N A;  1FR7 A;  1AM6 A;  1YO0 A;  3M2Y A;  1FQM A;  1UGE A;  3N0N A;  1TBT X;  3M67 A;  2AX2 A;  1CA2 A;  1HUH A;  2NWP A;  3CA2 A;  3MWO A;  2Q1Q A;  2ILI A;  3DCC A;  2HFY A;  3DVD A;  1DCB A;  2NXT A;  1G46 A;  1LGD A;  1G52 A;  3IGP A;  1DMY A;  1ZNC A;  2X7U A;  2FNK A;  1FSN A;  3KS3 A;  3ML5 A;  1RJ6 A;  3DCS A;  2OSF A;  2NNV A;  2FNN A;  1FQL A;  1CVB A;  1IF8 A;  1KWQ A;  3MNK A;  2NN1 A;  2F14 A;  1YDD A;  3P4V A;  1TE3 X;  8CA2 A;  1ZE8 A;  3DCW A;  2EU3 A;  2X7T A;  1KOP A;  4CAC A;  1CAM A;  1G0F A;  1CCT A;  1ZSC A;  3B1B A;  2CBC A;  1UGB A;  2VVA X;  3M40 A;  1CVA A;  1IF7 A;  2ZNC A;  1FSR A;  2Q38 A;  2WD2 A;  1BN1 A;  3EFT A;  1OQ5 A;  1I9M A;  1CVF A;  1XEV A;  1AVN A;  3DD0 A;  1CAI A;  1XPZ A;  3R16 A;  3IBN A;  3BET A;  1CAH A;  3BL1 A;  1H9N A;  3OIL A;  3M5T A;  2FNM A;  1RAZ A;  2ABE A;  1XEG A;  2HL4 A;  3FW3 A;  2VVB X;  1HEC A;  2X7S A;  3DC3 A;  1G6V A;  2HOC A;  3KKX A;  1BNQ A;  3M1Q A;  1ZSA A;  1LZV A;  3NI5 A;  1Y7W A;  3OIM A;  2WD3 A;  1BNM A;  1CA3 A;  3MNU A;  3FE4 A;  3M5S A;  2FW4 A;  1IF6 A;  1FQN A;  3D8W A;  1CVE A;  1ZSB A;  1Z93 A;  3M98 A;  1I90 A;  1KWR A;  1HEB A;  2OSM A;  2HNC A;  3ZNC A;  1JV0 A;  2HD6 A;  1BIC A;  2CBA A;  3OKV A;  1BNU A;  1RAY A;  1BN3 A;  2FOU A;  3C7P A;  2FMG A;  3F4X A;  1CNY A;  1CNI A;  3KIG A;  1THK A;  3BL0 A;  2POW A;  3HKN A;  3DD8 A;  1T9N A;  3D92 A;  3M96 A;  3HKQ A;  1HUG A;  1Z97 A;  2WEO A;  1OKM A;  1CNW A;  1LG6 A;  1YDC A;  3MHI A;  2NNS A;  2NNO A;  1CNC A;  1CCS A;  3DV7 A;  3K2F A;  1G45 A;  1G1D A;  4PYY A;  2HKK A;  2HFX A;  2NWY A;  1I9P A;  2WEJ A;  3KOK A;  1I91 A;  1LG5 A;  1TTM A;  1TG3 A;  3ML2 A;  1BV3 A;  3CZV A;  1YDA A;  1KOQ A;  1RZB A;  2NWZ A;  3IBI A;  2CBB A;  3OKU A;  2CBE A;  3L14 A;  1CRM A;  1G4O A;  1UGA A;  1CZM A;  3MHL A;  1DCA A;  3HKT A;  1BNV A;  1CIM A;  2NWO A;  2O4Z A;  3D0N A;  1CAK A;  1CRA A;  2FOS A;  3OIK A;  3GZ0 A;  1URT A;  1HCB A;  1IF4 A;  3MHC A;  3M2Z A;  1CCU A;  5CA2 A;  3MNJ A;  1IF5 A;  1FQR A;  3JXH C;  1FSQ A;  2WEG A;  1CVH A;  3N2P A;  2CA2 A;  3MNI A;  3MZC A;  1I8Z A;  2POU A;  1AZM A;  1CAO A;  1YDB A;  1H9Q A;  1YO1 A;  2EU2 A;  3HLJ A;  1JD0 A;  3EFI A;  3B4F A;  3HFP A;  1FR4 A;  1BNW A;  3LXE A;  3N4B A;  1CIL A;  3DVB A;  2EZ7 A;  2AW1 A;  1F2W A;  1UGF A;  1CIN A;  1UGD A;  1CNJ A;  1HCA A;  2WEH A;  1FLJ A;  3JXF A;  6CA2 A;  3FFP X;  1HED A;  3MYQ A;  1CNH A;  2FOQ A;  2GEH A;  1BNT A;  1A42 A;  1G48 A;  1G0E A;  1BCD A;  2NNG A;  3MDZ A;  3DBU A;  3PYK A;  1RZE A;  3DVC A;  2GD8 A;  3IEO A;  1CAJ A;  3KWA A;  1RJ5 A;  3MMF A;  1I9O A;  1CNX A;  3F7B A;  12CA A;  1IF9 A;  3MNA A;  1RZC A;  3F7U A;  3K7K A;  2CAB A;  3HKU A;  1BZM A;  3JXG A;  3M5E A;  1XQ0 A;  4CA2 A;  3K34 A;  3D9Z A;  1OKN A;  1G3Z A;  1HEA A;  3CAJ A;  1J9W A;  3N3J A;  1KEQ A;  3IBL A;  3DAZ A;  2FMZ A; 
#chains in the KnotProt database with same CATH topology
 2NXS A;  3DC9 A;  1I9Q A;  3F8E A;  3MHM A;  2NN7 A;  1RZD A;  3DA2 A;  1CAZ A;  3MNH A;  1CVD A;  1MUA A;  2CBD A;  2H15 A;  3KON A;  3IQK A;  1YO2 A;  2IT4 A;  1G53 A;  7CA2 A;  5CAC A;  1CAY A;  3NJ9 A;  1CVC A;  1I9L A;  1TEU X;  1LUG A;  2Q1B A;  1BN4 A;  1CNG A;  3M2N A;  9CA2 A;  3MHO A;  1V9I C;  3R17 B;  2NXR A;  3D93 A;  1I9N A;  3IAI A;  1RZA A;  2POV A;  3M1W A;  2NMX A;  1G4J A;  1BNN A;  3HS4 A;  1HVA A;  1CAL A;  3PO6 A;  3IBU A;  1CAN A;  1V9E A;  2W2J A;  3M1J A;  1TH9 A;  2HFW A;  3M3X A;  1TG9 A;  1EOU A;  1H4N A;  1FR7 A;  1AM6 A;  1YO0 A;  3M2Y A;  1FQM A;  1UGE A;  3N0N A;  1TBT X;  3M67 A;  2AX2 A;  1CA2 A;  1HUH A;  2NWP A;  3CA2 A;  3MWO A;  2Q1Q A;  2ILI A;  3DCC A;  2HFY A;  3DVD A;  1DCB A;  2NXT A;  1G46 A;  1LGD A;  1G52 A;  3IGP A;  1DMY A;  1ZNC A;  2X7U A;  2FNK A;  1FSN A;  3KS3 A;  3ML5 A;  1RJ6 A;  3DCS A;  2OSF A;  2NNV A;  2FNN A;  1FQL A;  1CVB A;  1IF8 A;  1KWQ A;  3MNK A;  2NN1 A;  2F14 A;  1YDD A;  3P4V A;  1TE3 X;  8CA2 A;  1ZE8 A;  3DCW A;  2EU3 A;  2X7T A;  1KOP A;  4CAC A;  1CAM A;  1G0F A;  1CCT A;  1ZSC A;  3B1B A;  2CBC A;  1UGB A;  2VVA X;  3M40 A;  1CVA A;  1IF7 A;  2ZNC A;  1FSR A;  2Q38 A;  2WD2 A;  1BN1 A;  3EFT A;  1OQ5 A;  1I9M A;  1CVF A;  1XEV A;  1AVN A;  3DD0 A;  1CAI A;  1XPZ A;  3R16 A;  3IBN A;  3BET A;  1CAH A;  3BL1 A;  1H9N A;  3OIL A;  3M5T A;  2FNM A;  1RAZ A;  2ABE A;  1XEG A;  2HL4 A;  3FW3 A;  2VVB X;  1HEC A;  2X7S A;  3DC3 A;  1G6V A;  2HOC A;  3KKX A;  1BNQ A;  3M1Q A;  1ZSA A;  1LZV A;  3NI5 A;  1Y7W A;  3OIM A;  2WD3 A;  1BNM A;  1CA3 A;  3MNU A;  3FE4 A;  3M5S A;  2FW4 A;  1IF6 A;  1FQN A;  3D8W A;  1CVE A;  1ZSB A;  1Z93 A;  3M98 A;  1I90 A;  1KWR A;  1HEB A;  2OSM A;  2HNC A;  3ZNC A;  1JV0 A;  2HD6 A;  1BIC A;  2CBA A;  3OKV A;  1BNU A;  1RAY A;  1BN3 A;  2FOU A;  3C7P A;  2FMG A;  3F4X A;  1CNY A;  1CNI A;  3KIG A;  1THK A;  3BL0 A;  2POW A;  3HKN A;  3DD8 A;  1T9N A;  3D92 A;  3M96 A;  3HKQ A;  1HUG A;  1Z97 A;  2WEO A;  1OKM A;  1CNW A;  1LG6 A;  1YDC A;  3MHI A;  2NNS A;  2NNO A;  1CNC A;  1CCS A;  3DV7 A;  3K2F A;  1G45 A;  1G1D A;  4PYY A;  2HKK A;  2HFX A;  2NWY A;  1I9P A;  2WEJ A;  3KOK A;  1I91 A;  1LG5 A;  1TTM A;  1TG3 A;  3ML2 A;  1BV3 A;  3CZV A;  1YDA A;  1KOQ A;  1RZB A;  2NWZ A;  3IBI A;  2CBB A;  3OKU A;  2CBE A;  3L14 A;  1CRM A;  1G4O A;  1UGA A;  1CZM A;  3MHL A;  1DCA A;  3HKT A;  1BNV A;  1CIM A;  2NWO A;  2O4Z A;  3D0N A;  1CAK A;  1CRA A;  2FOS A;  3OIK A;  3GZ0 A;  1URT A;  1HCB A;  1IF4 A;  3MHC A;  3M2Z A;  1CCU A;  5CA2 A;  3MNJ A;  1IF5 A;  1FQR A;  3JXH C;  1FSQ A;  2WEG A;  1CVH A;  3N2P A;  2CA2 A;  3MNI A;  3MZC A;  1I8Z A;  2POU A;  1AZM A;  1CAO A;  1YDB A;  1H9Q A;  1YO1 A;  2EU2 A;  3HLJ A;  1JD0 A;  3EFI A;  3B4F A;  3HFP A;  1FR4 A;  1BNW A;  3LXE A;  3N4B A;  1CIL A;  3DVB A;  2EZ7 A;  2AW1 A;  1F2W A;  1UGF A;  1CIN A;  1UGD A;  1CNJ A;  1HCA A;  2WEH A;  1FLJ A;  3JXF A;  6CA2 A;  3FFP X;  1HED A;  3MYQ A;  1CNH A;  2FOQ A;  2GEH A;  1BNT A;  1A42 A;  1G48 A;  1G0E A;  1BCD A;  2NNG A;  3MDZ A;  3DBU A;  3PYK A;  1RZE A;  3DVC A;  2GD8 A;  3IEO A;  1CAJ A;  3KWA A;  1RJ5 A;  3MMF A;  1I9O A;  1CNX A;  3F7B A;  12CA A;  1IF9 A;  3MNA A;  1RZC A;  3F7U A;  3K7K A;  2CAB A;  3HKU A;  1BZM A;  3JXG A;  3M5E A;  1XQ0 A;  4CA2 A;  3K34 A;  3D9Z A;  1OKN A;  1G3Z A;  1HEA A;  3CAJ A;  1J9W A;  3N3J A;  1KEQ A;  3IBL A;  3DAZ A;  2FMZ A; 
#chains in the KnotProt database with same CATH homology
 2NXS A;  3DC9 A;  1I9Q A;  3F8E A;  3MHM A;  2NN7 A;  1RZD A;  3DA2 A;  1CAZ A;  3MNH A;  1CVD A;  1MUA A;  2CBD A;  2H15 A;  3KON A;  3IQK A;  1YO2 A;  2IT4 A;  1G53 A;  7CA2 A;  5CAC A;  1CAY A;  3NJ9 A;  1CVC A;  1I9L A;  1TEU X;  1LUG A;  2Q1B A;  1BN4 A;  1CNG A;  3M2N A;  9CA2 A;  3MHO A;  1V9I C;  3R17 B;  2NXR A;  3D93 A;  1I9N A;  3IAI A;  1RZA A;  2POV A;  3M1W A;  2NMX A;  1G4J A;  1BNN A;  3HS4 A;  1HVA A;  1CAL A;  3PO6 A;  3IBU A;  1CAN A;  1V9E A;  2W2J A;  3M1J A;  1TH9 A;  2HFW A;  3M3X A;  1TG9 A;  1EOU A;  1H4N A;  1FR7 A;  1AM6 A;  1YO0 A;  3M2Y A;  1FQM A;  1UGE A;  3N0N A;  1TBT X;  3M67 A;  2AX2 A;  1CA2 A;  1HUH A;  2NWP A;  3CA2 A;  3MWO A;  2Q1Q A;  2ILI A;  3DCC A;  2HFY A;  3DVD A;  1DCB A;  2NXT A;  1G46 A;  1LGD A;  1G52 A;  3IGP A;  1DMY A;  1ZNC A;  2X7U A;  2FNK A;  1FSN A;  3KS3 A;  3ML5 A;  1RJ6 A;  3DCS A;  2OSF A;  2NNV A;  2FNN A;  1FQL A;  1CVB A;  1IF8 A;  1KWQ A;  3MNK A;  2NN1 A;  2F14 A;  1YDD A;  3P4V A;  1TE3 X;  8CA2 A;  1ZE8 A;  3DCW A;  2EU3 A;  2X7T A;  1KOP A;  4CAC A;  1CAM A;  1G0F A;  1CCT A;  1ZSC A;  3B1B A;  2CBC A;  1UGB A;  2VVA X;  3M40 A;  1CVA A;  1IF7 A;  2ZNC A;  1FSR A;  2Q38 A;  2WD2 A;  1BN1 A;  3EFT A;  1OQ5 A;  1I9M A;  1CVF A;  1XEV A;  1AVN A;  3DD0 A;  1CAI A;  1XPZ A;  3R16 A;  3IBN A;  3BET A;  1CAH A;  3BL1 A;  1H9N A;  3OIL A;  3M5T A;  2FNM A;  1RAZ A;  2ABE A;  1XEG A;  2HL4 A;  3FW3 A;  2VVB X;  1HEC A;  2X7S A;  3DC3 A;  1G6V A;  2HOC A;  3KKX A;  1BNQ A;  3M1Q A;  1ZSA A;  1LZV A;  3NI5 A;  1Y7W A;  3OIM A;  2WD3 A;  1BNM A;  1CA3 A;  3MNU A;  3FE4 A;  3M5S A;  2FW4 A;  1IF6 A;  1FQN A;  3D8W A;  1CVE A;  1ZSB A;  1Z93 A;  3M98 A;  1I90 A;  1KWR A;  1HEB A;  2OSM A;  2HNC A;  3ZNC A;  1JV0 A;  2HD6 A;  1BIC A;  2CBA A;  3OKV A;  1BNU A;  1RAY A;  1BN3 A;  2FOU A;  3C7P A;  2FMG A;  3F4X A;  1CNY A;  1CNI A;  3KIG A;  1THK A;  3BL0 A;  2POW A;  3HKN A;  3DD8 A;  1T9N A;  3D92 A;  3M96 A;  3HKQ A;  1HUG A;  1Z97 A;  2WEO A;  1OKM A;  1CNW A;  1LG6 A;  1YDC A;  3MHI A;  2NNS A;  2NNO A;  1CNC A;  1CCS A;  3DV7 A;  3K2F A;  1G45 A;  1G1D A;  2HKK A;  2HFX A;  2NWY A;  1I9P A;  2WEJ A;  3KOK A;  1I91 A;  1LG5 A;  1TTM A;  1TG3 A;  3ML2 A;  1BV3 A;  3CZV A;  1YDA A;  1KOQ A;  1RZB A;  2NWZ A;  3IBI A;  2CBB A;  3OKU A;  2CBE A;  3L14 A;  1CRM A;  1G4O A;  1UGA A;  1CZM A;  3MHL A;  1DCA A;  3HKT A;  1BNV A;  1CIM A;  2NWO A;  2O4Z A;  3D0N A;  1CAK A;  1CRA A;  2FOS A;  3OIK A;  3GZ0 A;  1URT A;  1HCB A;  1IF4 A;  3MHC A;  3M2Z A;  1CCU A;  5CA2 A;  3MNJ A;  1IF5 A;  1FQR A;  3JXH C;  1FSQ A;  2WEG A;  1CVH A;  3N2P A;  2CA2 A;  3MNI A;  3MZC A;  1I8Z A;  2POU A;  1AZM A;  1CAO A;  1YDB A;  1H9Q A;  1YO1 A;  2EU2 A;  3HLJ A;  1JD0 A;  3EFI A;  3B4F A;  3HFP A;  1FR4 A;  1BNW A;  3LXE A;  3N4B A;  1CIL A;  3DVB A;  2EZ7 A;  2AW1 A;  1F2W A;  1UGF A;  1CIN A;  1UGD A;  1CNJ A;  1HCA A;  2WEH A;  1FLJ A;  3JXF A;  6CA2 A;  3FFP X;  1HED A;  3MYQ A;  1CNH A;  2FOQ A;  2GEH A;  1BNT A;  1A42 A;  1G48 A;  1G0E A;  1BCD A;  2NNG A;  3MDZ A;  3DBU A;  3PYK A;  1RZE A;  3DVC A;  2GD8 A;  3IEO A;  1CAJ A;  3KWA A;  1RJ5 A;  3MMF A;  1I9O A;  1CNX A;  3F7B A;  12CA A;  1IF9 A;  3MNA A;  1RZC A;  3F7U A;  3K7K A;  2CAB A;  3HKU A;  1BZM A;  3JXG A;  3M5E A;  1XQ0 A;  4CA2 A;  3K34 A;  3D9Z A;  1OKN A;  1G3Z A;  1HEA A;  3CAJ A;  1J9W A;  3N3J A;  1KEQ A;  3IBL A;  3DAZ A;  2FMZ A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling