2NNGA

Structure of inhibitor binding to carbonic anhydrase ii
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 25-256 232 1-24, 257-259 24 2 slipknot
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLE-VTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 3x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 23-255 233 1-22, 256-259 22 4 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureHis3 <-> Lys261
... His96 <->
Bridging ionZn262
<-> His94 ... His3
probabilistic
K +31 His3 ... His96 <->
Bridging ionZn262
<-> His119 ...
Chain closureLys261 <-> His3
probabilistic
K +31 His3 ... His94 <->
Bridging ionZn262
<-> His119 ...
Chain closureLys261 <-> His3
probabilistic
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLE-VTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 26-257 232 1-25, 258-258 25 1 knot
view details
2.1 25-252 228 1-24 258-258 253-257 24 1 slipknot
sequence length 258
structure length 257
publication title Structural Analysis of Charge Discrimination in the Binding of Inhibitors to Human Carbonic Anhydrases I and II.
pubmed doi rcsb
molecule tags Lyase
molecule keywords Carbonic anhydrase 2
source organism Homo sapiens
missing residues 203
total genus Genus: 77
ec nomenclature ec 4.2.1.1: Carbonate dehydratase.
pdb deposition date 2006-10-24
KnotProt deposition date 2018-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Carbonic Anhydrase II 2nngA00
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Carbonic Anhydrase II 2nngA00
3DC9A 1TEUX 5CA2A 1CNXA 1I9PA 1I9QA 1RJ6A 1BNWA 2HFXA 1YO2A 3DD8A 2POUA 1RZDA 2NWYA 1HUHA 2HFWA 1KOQA 1RJ5A 3ML2A 2NXRA 1AM6A 3MNJA 1RAZA 3KWAA 3IQKA 3KS3A 3MNKA 3BL1A 2FNKA 3BETA 3NJ9A 1YDBA 1HEDA 1IF7A 1RZCA 1LUGA 1HEBA 3N3JA 3MNAA 1UGFA 2WEOA 1CALA 3IBNA 2HL4A 2NWOA 1V9IC 1TH9A 1ZSBA 1OQ5A 1G4JA 1CNCA 1FR4A 2NWPA 2NNSA 2H15A 1I9MA 2EU2A 2FOSA 2NNVA 1KWRA 2X7SA 1KOPA 2NNOA 1CNHA 1T9NA 2POWA 2Q38A 1HVAA 1IF8A 3IBIA 1BZMA 1LZVA 1CAZA 1IF4A 3M5EA 3EFIA 3BL0A 1TG9A 9CA2A 2CBBA 3OKVA 1G48A 1I9NA 2VVBX 1FQLA 3N2PA 3DCSA 1LG5A 1A42A 3JXGA 2HFYA 2OSFA 1CVAA 1FQNA 3M5SA 1CCUA 3B1BA 2FNMA 1RZAA 3HKNA 1BN4A 3M67A 3MHLA 3M40A 2CA2A 3FW3A 3M2YA 4PYYA 3KONA 1HEAA 1CVFA 1I9OA 3D0NA 1FSNA 2ZNCA 1BN1A 2FW4A 3IGPA 1BN3A 1CNWA 1RAYA 3MHOA 1BCDA 1G53A 1YO0A 3F4XA 3MNUA 1CANA 3L14A 2WEJA 1UGAA 3JXFA 2NNGA 3NI5A 3OIKA 3PO6A 2VVAX 2AX2A 2POVA 3P4VA 2FNNA 2WD2A 1CVEA 1HECA 3PYKA 3HKTA 3D92A 3HLJA 1G0FA 2EZ7A 3N4BA 3D93A 3HKQA 1J9WA 3HS4A 3MHMA 4CA2A 1HUGA 2O4ZA 1BNTA 3IBUA 1RZBA 2GD8A 2AW1A 1UGBA 3KOKA 1URTA 1OKMA 3IAIA 3N0NA 1I8ZA 1JV0A 3R16A 3MNHA 5CACA 1IF5A 1CAOA 3M98A 3DC3A 1DMYA 3DA2A 1G0EA 3MDZA 2CBAA 2F14A 1CINA 1IF9A 1CAIA 3MWOA 1CAKA 1BICA 3CA2A 1CA2A 1CA3A 3FFPX 3MHIA 3IBLA 1LG6A 3CAJA 1G52A 3DCWA 1CVCA 1G4OA 2W2JA 3DCCA 2NN1A 1CIMA 1CCSA 3MYQA 1JD0A 1FR7A 3DAZA 2X7TA 3MNIA 3OKUA 2Q1QA 1ZNCA 1CCTA 1I90A 1H4NA 3K2FA 1BNUA 1BNVA 1KEQA 3M96A 1H9QA 3OIMA 1TBTX 3F7UA 1BNNA 6CA2A 7CA2A 3F8EA 3K7KA 2NXSA 3F7BA 2NN7A 2ILIA 1YO1A 1CNIA 2OSMA 1H9NA 1CNJA 1ZSCA 3DVCA 1XEGA 2EU3A 3KKXA 3ML5A 1OKNA 1F2WA 3OILA 3B4FA 1CAMA 1I91A 2WD3A 3K34A 3DVDA 1BV3A 1IF6A 1DCBA 2WEGA 3JXHC 3M1JA 1CILA 2NWZA 1UGEA 1DCAA 1CAYA 1CAJA 1UGDA 1THKA 3D9ZA 3M1WA 2HD6A 2CBDA 3MZCA 1CNYA 2HOCA 3M1QA 1CVHA 2CABA 2X7UA 1MUAA 1I9LA 1HCAA 1Y7WA 1BNQA 12CAA 1AVNA 3DD0A 1CRMA 3LXEA 2NMXA 1G46A 1YDDA 3R17B 1G1DA 3C7PA 3ZNCA 3M2ZA 3DVBA 1XEVA 1BNMA 1TTMA 4CACA 1FSQA 2HKKA 1XQ0A 1CVBA 1TE3X 1Z97A 1FQRA 1ZSAA 3MMFA 1FLJA 1G3ZA 3M3XA 1CAHA 3HKUA 3DBUA 3EFTA 2HNCA 2FMZA 1G45A 1CZMA 1YDCA 1KWQA 1Z93A 1EOUA 2GEHA 2CBEA 1G6VA 1CRAA 1V9EA 2WEHA 3M5TA 1XPZA 1ZE8A 3KIGA 2NXTA 3MHCA 3FE4A 2ABEA 3IEOA 3GZ0A 3D8WA 2Q1BA 1CNGA 1AZMA 1TG3A 1LGDA 1FQMA 1FSRA 3DV7A 3M2NA 8CA2A 1RZEA 2FMGA 2IT4A 1HCBA 1CVDA 3CZVA 2CBCA 2FOQA 1YDAA 3HFPA 2FOUA
chains in the KnotProt database with same CATH superfamily
3DC9A 1TEUX 5CA2A 1CNXA 1I9PA 1I9QA 1RJ6A 1BNWA 2HFXA 1YO2A 3DD8A 2POUA 1RZDA 2NWYA 1HUHA 2HFWA 1KOQA 1RJ5A 3ML2A 2NXRA 1AM6A 3MNJA 1RAZA 3KWAA 3IQKA 3KS3A 3MNKA 3BL1A 2FNKA 3BETA 3NJ9A 1YDBA 1HEDA 1IF7A 1RZCA 1LUGA 1HEBA 3N3JA 3MNAA 1UGFA 2WEOA 1CALA 3IBNA 2HL4A 2NWOA 1V9IC 1TH9A 1ZSBA 1OQ5A 1G4JA 1CNCA 1FR4A 2NWPA 2NNSA 2H15A 1I9MA 2EU2A 2FOSA 2NNVA 1KWRA 2X7SA 1KOPA 2NNOA 1CNHA 1T9NA 2POWA 2Q38A 1HVAA 1IF8A 3IBIA 1BZMA 1LZVA 1CAZA 1IF4A 3M5EA 3EFIA 3BL0A 1TG9A 9CA2A 2CBBA 3OKVA 1G48A 1I9NA 2VVBX 1FQLA 3N2PA 3DCSA 1LG5A 1A42A 3JXGA 2HFYA 2OSFA 1CVAA 1FQNA 3M5SA 1CCUA 3B1BA 2FNMA 1RZAA 3HKNA 1BN4A 3M67A 3MHLA 3M40A 2CA2A 3FW3A 3M2YA 4PYYA 3KONA 1HEAA 1CVFA 1I9OA 3D0NA 1FSNA 2ZNCA 1BN1A 2FW4A 3IGPA 1BN3A 1CNWA 1RAYA 3MHOA 1BCDA 1G53A 1YO0A 3F4XA 3MNUA 1CANA 3L14A 2WEJA 1UGAA 3JXFA 2NNGA 3NI5A 3OIKA 3PO6A 2VVAX 2AX2A 2POVA 3P4VA 2FNNA 2WD2A 1CVEA 1HECA 3PYKA 3HKTA 3D92A 3HLJA 1G0FA 2EZ7A 3N4BA 3D93A 3HKQA 1J9WA 3HS4A 3MHMA 4CA2A 1HUGA 2O4ZA 1BNTA 3IBUA 1RZBA 2GD8A 2AW1A 1UGBA 3KOKA 1URTA 1OKMA 3IAIA 3N0NA 1I8ZA 1JV0A 3R16A 3MNHA 5CACA 1IF5A 1CAOA 3M98A 3DC3A 1DMYA 3DA2A 1G0EA 3MDZA 2CBAA 2F14A 1CINA 1IF9A 1CAIA 3MWOA 1CAKA 1BICA 3CA2A 1CA2A 1CA3A 3FFPX 3MHIA 3IBLA 1LG6A 3CAJA 1G52A 3DCWA 1CVCA 1G4OA 2W2JA 3DCCA 2NN1A 1CIMA 1CCSA 3MYQA 1JD0A 1FR7A 3DAZA 2X7TA 3MNIA 3OKUA 2Q1QA 1ZNCA 1CCTA 1I90A 1H4NA 3K2FA 1BNUA 1BNVA 1KEQA 3M96A 1H9QA 3OIMA 1TBTX 3F7UA 1BNNA 6CA2A 7CA2A 3F8EA 3K7KA 2NXSA 3F7BA 2NN7A 2ILIA 1YO1A 1CNIA 2OSMA 1H9NA 1CNJA 1ZSCA 3DVCA 1XEGA 2EU3A 3KKXA 3ML5A 1OKNA 1F2WA 3OILA 3B4FA 1CAMA 1I91A 2WD3A 3K34A 3DVDA 1BV3A 1IF6A 1DCBA 2WEGA 3JXHC 3M1JA 1CILA 2NWZA 1UGEA 1DCAA 1CAYA 1CAJA 1UGDA 1THKA 3D9ZA 3M1WA 2HD6A 2CBDA 3MZCA 1CNYA 2HOCA 3M1QA 1CVHA 2CABA 2X7UA 1MUAA 1I9LA 1HCAA 1Y7WA 1BNQA 12CAA 1AVNA 3DD0A 1CRMA 3LXEA 2NMXA 1G46A 1YDDA 3R17B 1G1DA 3C7PA 3ZNCA 3M2ZA 3DVBA 1XEVA 1BNMA 1TTMA 4CACA 1FSQA 2HKKA 1XQ0A 1CVBA 1TE3X 1Z97A 1FQRA 1ZSAA 3MMFA 1FLJA 1G3ZA 3M3XA 1CAHA 3HKUA 3DBUA 3EFTA 2HNCA 2FMZA 1G45A 1CZMA 1YDCA 1KWQA 1Z93A 1EOUA 2GEHA 2CBEA 1G6VA 1CRAA 1V9EA 2WEHA 3M5TA 1XPZA 1ZE8A 3KIGA 2NXTA 3MHCA 3FE4A 2ABEA 3IEOA 3GZ0A 3D8WA 2Q1BA 1CNGA 1AZMA 1TG3A 1LGDA 1FQMA 1FSRA 3DV7A 3M2NA 8CA2A 1RZEA 2FMGA 2IT4A 1HCBA 1CVDA 3CZVA 2CBCA 2FOQA 1YDAA 3HFPA 2FOUA
chains in the KnotProt database with same CATH topology
3DC9A 1TEUX 5CA2A 1CNXA 1I9PA 1I9QA 1RJ6A 1BNWA 2HFXA 1YO2A 3DD8A 2POUA 1RZDA 2NWYA 1HUHA 2HFWA 1KOQA 1RJ5A 3ML2A 2NXRA 1AM6A 3MNJA 1RAZA 3KWAA 3IQKA 3KS3A 3MNKA 3BL1A 2FNKA 3BETA 3NJ9A 1YDBA 1HEDA 1IF7A 1RZCA 1LUGA 1HEBA 3N3JA 3MNAA 1UGFA 2WEOA 1CALA 3IBNA 2HL4A 2NWOA 1V9IC 1TH9A 1ZSBA 1OQ5A 1G4JA 1CNCA 1FR4A 2NWPA 2NNSA 2H15A 1I9MA 2EU2A 2FOSA 2NNVA 1KWRA 2X7SA 1KOPA 2NNOA 1CNHA 1T9NA 2POWA 2Q38A 1HVAA 1IF8A 3IBIA 1BZMA 1LZVA 1CAZA 1IF4A 3M5EA 3EFIA 3BL0A 1TG9A 9CA2A 2CBBA 3OKVA 1G48A 1I9NA 2VVBX 1FQLA 3N2PA 3DCSA 1LG5A 1A42A 3JXGA 2HFYA 2OSFA 1CVAA 1FQNA 3M5SA 1CCUA 3B1BA 2FNMA 1RZAA 3HKNA 1BN4A 3M67A 3MHLA 3M40A 2CA2A 3FW3A 3M2YA 3KONA 1HEAA 1CVFA 1I9OA 3D0NA 1FSNA 2ZNCA 1BN1A 2FW4A 3IGPA 1BN3A 1CNWA 1RAYA 3MHOA 1BCDA 1G53A 1YO0A 3F4XA 3MNUA 1CANA 3L14A 2WEJA 1UGAA 3JXFA 2NNGA 3NI5A 3OIKA 3PO6A 2VVAX 2AX2A 2POVA 3P4VA 2FNNA 2WD2A 1CVEA 1HECA 3PYKA 3HKTA 3D92A 3HLJA 1G0FA 2EZ7A 3N4BA 3D93A 3HKQA 1J9WA 3HS4A 3MHMA 4CA2A 1HUGA 2O4ZA 1BNTA 3IBUA 1RZBA 2GD8A 2AW1A 1UGBA 3KOKA 1URTA 1OKMA 3IAIA 3N0NA 1I8ZA 1JV0A 3R16A 3MNHA 5CACA 1IF5A 1CAOA 3M98A 3DC3A 1DMYA 3DA2A 1G0EA 3MDZA 2CBAA 2F14A 1CINA 1IF9A 1CAIA 3MWOA 1CAKA 1BICA 3CA2A 1CA2A 1CA3A 3FFPX 3MHIA 3IBLA 1LG6A 3CAJA 1G52A 3DCWA 1CVCA 1G4OA 2W2JA 3DCCA 2NN1A 1CIMA 1CCSA 3MYQA 1JD0A 1FR7A 3DAZA 2X7TA 3MNIA 3OKUA 2Q1QA 1ZNCA 1CCTA 1I90A 1H4NA 3K2FA 1BNUA 1BNVA 1KEQA 3M96A 1H9QA 3OIMA 1TBTX 3F7UA 1BNNA 6CA2A 7CA2A 3F8EA 3K7KA 2NXSA 3F7BA 2NN7A 2ILIA 1YO1A 1CNIA 2OSMA 1H9NA 1CNJA 1ZSCA 3DVCA 1XEGA 2EU3A 3KKXA 3ML5A 1OKNA 1F2WA 3OILA 3B4FA 1CAMA 1I91A 2WD3A 3K34A 3DVDA 1BV3A 1IF6A 1DCBA 2WEGA 3JXHC 3M1JA 1CILA 2NWZA 1UGEA 1DCAA 1CAYA 1CAJA 1UGDA 1THKA 3D9ZA 3M1WA 2HD6A 2CBDA 3MZCA 1CNYA 2HOCA 3M1QA 1CVHA 2CABA 2X7UA 1MUAA 1I9LA 1HCAA 1Y7WA 1BNQA 12CAA 1AVNA 3DD0A 1CRMA 3LXEA 2NMXA 1G46A 1YDDA 3R17B 1G1DA 3C7PA 3ZNCA 3M2ZA 3DVBA 1XEVA 1BNMA 1TTMA 4CACA 1FSQA 2HKKA 1XQ0A 1CVBA 1TE3X 1Z97A 1FQRA 1ZSAA 3MMFA 1FLJA 1G3ZA 3M3XA 1CAHA 3HKUA 3DBUA 3EFTA 2HNCA 2FMZA 1G45A 1CZMA 1YDCA 1KWQA 1Z93A 1EOUA 2GEHA 2CBEA 1G6VA 1CRAA 1V9EA 2WEHA 3M5TA 1XPZA 1ZE8A 3KIGA 2NXTA 3MHCA 3FE4A 2ABEA 3IEOA 3GZ0A 3D8WA 2Q1BA 1CNGA 1AZMA 1TG3A 1LGDA 1FQMA 1FSRA 3DV7A 3M2NA 8CA2A 1RZEA 2FMGA 2IT4A 1HCBA 1CVDA 3CZVA 2CBCA 2FOQA 1YDAA 3HFPA 2FOUA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3DC9 A;  1TEU X;  5CA2 A;  1CNX A;  1I9P A;  1I9Q A;  1RJ6 A;  1BNW A;  2HFX A;  1YO2 A;  3DD8 A;  2POU A;  1RZD A;  2NWY A;  1HUH A;  2HFW A;  1KOQ A;  1RJ5 A;  3ML2 A;  2NXR A;  1AM6 A;  3MNJ A;  1RAZ A;  3KWA A;  3IQK A;  3KS3 A;  3MNK A;  3BL1 A;  2FNK A;  3BET A;  3NJ9 A;  1YDB A;  1HED A;  1IF7 A;  1RZC A;  1LUG A;  1HEB A;  3N3J A;  3MNA A;  1UGF A;  2WEO A;  1CAL A;  3IBN A;  2HL4 A;  2NWO A;  1V9I C;  1TH9 A;  1ZSB A;  1OQ5 A;  1G4J A;  1CNC A;  1FR4 A;  2NWP A;  2NNS A;  2H15 A;  1I9M A;  2EU2 A;  2FOS A;  2NNV A;  1KWR A;  2X7S A;  1KOP A;  2NNO A;  1CNH A;  1T9N A;  2POW A;  2Q38 A;  1HVA A;  1IF8 A;  3IBI A;  1BZM A;  1LZV A;  1CAZ A;  1IF4 A;  3M5E A;  3EFI A;  3BL0 A;  1TG9 A;  9CA2 A;  2CBB A;  3OKV A;  1G48 A;  1I9N A;  2VVB X;  1FQL A;  3N2P A;  3DCS A;  1LG5 A;  1A42 A;  3JXG A;  2HFY A;  2OSF A;  1CVA A;  1FQN A;  3M5S A;  1CCU A;  3B1B A;  2FNM A;  1RZA A;  3HKN A;  1BN4 A;  3M67 A;  3MHL A;  3M40 A;  2CA2 A;  3FW3 A;  3M2Y A;  4PYY A;  3KON A;  1HEA A;  1CVF A;  1I9O A;  3D0N A;  1FSN A;  2ZNC A;  1BN1 A;  2FW4 A;  3IGP A;  1BN3 A;  1CNW A;  1RAY A;  3MHO A;  1BCD A;  1G53 A;  1YO0 A;  3F4X A;  3MNU A;  1CAN A;  3L14 A;  2WEJ A;  1UGA A;  3JXF A;  2NNG A;  3NI5 A;  3OIK A;  3PO6 A;  2VVA X;  2AX2 A;  2POV A;  3P4V A;  2FNN A;  2WD2 A;  1CVE A;  1HEC A;  3PYK A;  3HKT A;  3D92 A;  3HLJ A;  1G0F A;  2EZ7 A;  3N4B A;  3D93 A;  3HKQ A;  1J9W A;  3HS4 A;  3MHM A;  4CA2 A;  1HUG A;  2O4Z A;  1BNT A;  3IBU A;  1RZB A;  2GD8 A;  2AW1 A;  1UGB A;  3KOK A;  1URT A;  1OKM A;  3IAI A;  3N0N A;  1I8Z A;  1JV0 A;  3R16 A;  3MNH A;  5CAC A;  1IF5 A;  1CAO A;  3M98 A;  3DC3 A;  1DMY A;  3DA2 A;  1G0E A;  3MDZ A;  2CBA A;  2F14 A;  1CIN A;  1IF9 A;  1CAI A;  3MWO A;  1CAK A;  1BIC A;  3CA2 A;  1CA2 A;  1CA3 A;  3FFP X;  3MHI A;  3IBL A;  1LG6 A;  3CAJ A;  1G52 A;  3DCW A;  1CVC A;  1G4O A;  2W2J A;  3DCC A;  2NN1 A;  1CIM A;  1CCS A;  3MYQ A;  1JD0 A;  1FR7 A;  3DAZ A;  2X7T A;  3MNI A;  3OKU A;  2Q1Q A;  1ZNC A;  1CCT A;  1I90 A;  1H4N A;  3K2F A;  1BNU A;  1BNV A;  1KEQ A;  3M96 A;  1H9Q A;  3OIM A;  1TBT X;  3F7U A;  1BNN A;  6CA2 A;  7CA2 A;  3F8E A;  3K7K A;  2NXS A;  3F7B A;  2NN7 A;  2ILI A;  1YO1 A;  1CNI A;  2OSM A;  1H9N A;  1CNJ A;  1ZSC A;  3DVC A;  1XEG A;  2EU3 A;  3KKX A;  3ML5 A;  1OKN A;  1F2W A;  3OIL A;  3B4F A;  1CAM A;  1I91 A;  2WD3 A;  3K34 A;  3DVD A;  1BV3 A;  1IF6 A;  1DCB A;  2WEG A;  3JXH C;  3M1J A;  1CIL A;  2NWZ A;  1UGE A;  1DCA A;  1CAY A;  1CAJ A;  1UGD A;  1THK A;  3D9Z A;  3M1W A;  2HD6 A;  2CBD A;  3MZC A;  1CNY A;  2HOC A;  3M1Q A;  1CVH A;  2CAB A;  2X7U A;  1MUA A;  1I9L A;  1HCA A;  1Y7W A;  1BNQ A;  12CA A;  1AVN A;  3DD0 A;  1CRM A;  3LXE A;  2NMX A;  1G46 A;  1YDD A;  3R17 B;  1G1D A;  3C7P A;  3ZNC A;  3M2Z A;  3DVB A;  1XEV A;  1BNM A;  1TTM A;  4CAC A;  1FSQ A;  2HKK A;  1XQ0 A;  1CVB A;  1TE3 X;  1Z97 A;  1FQR A;  1ZSA A;  3MMF A;  1FLJ A;  1G3Z A;  3M3X A;  1CAH A;  3HKU A;  3DBU A;  3EFT A;  2HNC A;  2FMZ A;  1G45 A;  1CZM A;  1YDC A;  1KWQ A;  1Z93 A;  1EOU A;  2GEH A;  2CBE A;  1G6V A;  1CRA A;  1V9E A;  2WEH A;  3M5T A;  1XPZ A;  1ZE8 A;  3KIG A;  2NXT A;  3MHC A;  3FE4 A;  2ABE A;  3IEO A;  3GZ0 A;  3D8W A;  2Q1B A;  1CNG A;  1AZM A;  1TG3 A;  1LGD A;  1FQM A;  1FSR A;  3DV7 A;  3M2N A;  8CA2 A;  1RZE A;  2FMG A;  2IT4 A;  1HCB A;  1CVD A;  3CZV A;  2CBC A;  2FOQ A;  1YDA A;  3HFP A;  2FOU A; 
#chains in the KnotProt database with same CATH topology
 3DC9 A;  1TEU X;  5CA2 A;  1CNX A;  1I9P A;  1I9Q A;  1RJ6 A;  1BNW A;  2HFX A;  1YO2 A;  3DD8 A;  2POU A;  1RZD A;  2NWY A;  1HUH A;  2HFW A;  1KOQ A;  1RJ5 A;  3ML2 A;  2NXR A;  1AM6 A;  3MNJ A;  1RAZ A;  3KWA A;  3IQK A;  3KS3 A;  3MNK A;  3BL1 A;  2FNK A;  3BET A;  3NJ9 A;  1YDB A;  1HED A;  1IF7 A;  1RZC A;  1LUG A;  1HEB A;  3N3J A;  3MNA A;  1UGF A;  2WEO A;  1CAL A;  3IBN A;  2HL4 A;  2NWO A;  1V9I C;  1TH9 A;  1ZSB A;  1OQ5 A;  1G4J A;  1CNC A;  1FR4 A;  2NWP A;  2NNS A;  2H15 A;  1I9M A;  2EU2 A;  2FOS A;  2NNV A;  1KWR A;  2X7S A;  1KOP A;  2NNO A;  1CNH A;  1T9N A;  2POW A;  2Q38 A;  1HVA A;  1IF8 A;  3IBI A;  1BZM A;  1LZV A;  1CAZ A;  1IF4 A;  3M5E A;  3EFI A;  3BL0 A;  1TG9 A;  9CA2 A;  2CBB A;  3OKV A;  1G48 A;  1I9N A;  2VVB X;  1FQL A;  3N2P A;  3DCS A;  1LG5 A;  1A42 A;  3JXG A;  2HFY A;  2OSF A;  1CVA A;  1FQN A;  3M5S A;  1CCU A;  3B1B A;  2FNM A;  1RZA A;  3HKN A;  1BN4 A;  3M67 A;  3MHL A;  3M40 A;  2CA2 A;  3FW3 A;  3M2Y A;  4PYY A;  3KON A;  1HEA A;  1CVF A;  1I9O A;  3D0N A;  1FSN A;  2ZNC A;  1BN1 A;  2FW4 A;  3IGP A;  1BN3 A;  1CNW A;  1RAY A;  3MHO A;  1BCD A;  1G53 A;  1YO0 A;  3F4X A;  3MNU A;  1CAN A;  3L14 A;  2WEJ A;  1UGA A;  3JXF A;  2NNG A;  3NI5 A;  3OIK A;  3PO6 A;  2VVA X;  2AX2 A;  2POV A;  3P4V A;  2FNN A;  2WD2 A;  1CVE A;  1HEC A;  3PYK A;  3HKT A;  3D92 A;  3HLJ A;  1G0F A;  2EZ7 A;  3N4B A;  3D93 A;  3HKQ A;  1J9W A;  3HS4 A;  3MHM A;  4CA2 A;  1HUG A;  2O4Z A;  1BNT A;  3IBU A;  1RZB A;  2GD8 A;  2AW1 A;  1UGB A;  3KOK A;  1URT A;  1OKM A;  3IAI A;  3N0N A;  1I8Z A;  1JV0 A;  3R16 A;  3MNH A;  5CAC A;  1IF5 A;  1CAO A;  3M98 A;  3DC3 A;  1DMY A;  3DA2 A;  1G0E A;  3MDZ A;  2CBA A;  2F14 A;  1CIN A;  1IF9 A;  1CAI A;  3MWO A;  1CAK A;  1BIC A;  3CA2 A;  1CA2 A;  1CA3 A;  3FFP X;  3MHI A;  3IBL A;  1LG6 A;  3CAJ A;  1G52 A;  3DCW A;  1CVC A;  1G4O A;  2W2J A;  3DCC A;  2NN1 A;  1CIM A;  1CCS A;  3MYQ A;  1JD0 A;  1FR7 A;  3DAZ A;  2X7T A;  3MNI A;  3OKU A;  2Q1Q A;  1ZNC A;  1CCT A;  1I90 A;  1H4N A;  3K2F A;  1BNU A;  1BNV A;  1KEQ A;  3M96 A;  1H9Q A;  3OIM A;  1TBT X;  3F7U A;  1BNN A;  6CA2 A;  7CA2 A;  3F8E A;  3K7K A;  2NXS A;  3F7B A;  2NN7 A;  2ILI A;  1YO1 A;  1CNI A;  2OSM A;  1H9N A;  1CNJ A;  1ZSC A;  3DVC A;  1XEG A;  2EU3 A;  3KKX A;  3ML5 A;  1OKN A;  1F2W A;  3OIL A;  3B4F A;  1CAM A;  1I91 A;  2WD3 A;  3K34 A;  3DVD A;  1BV3 A;  1IF6 A;  1DCB A;  2WEG A;  3JXH C;  3M1J A;  1CIL A;  2NWZ A;  1UGE A;  1DCA A;  1CAY A;  1CAJ A;  1UGD A;  1THK A;  3D9Z A;  3M1W A;  2HD6 A;  2CBD A;  3MZC A;  1CNY A;  2HOC A;  3M1Q A;  1CVH A;  2CAB A;  2X7U A;  1MUA A;  1I9L A;  1HCA A;  1Y7W A;  1BNQ A;  12CA A;  1AVN A;  3DD0 A;  1CRM A;  3LXE A;  2NMX A;  1G46 A;  1YDD A;  3R17 B;  1G1D A;  3C7P A;  3ZNC A;  3M2Z A;  3DVB A;  1XEV A;  1BNM A;  1TTM A;  4CAC A;  1FSQ A;  2HKK A;  1XQ0 A;  1CVB A;  1TE3 X;  1Z97 A;  1FQR A;  1ZSA A;  3MMF A;  1FLJ A;  1G3Z A;  3M3X A;  1CAH A;  3HKU A;  3DBU A;  3EFT A;  2HNC A;  2FMZ A;  1G45 A;  1CZM A;  1YDC A;  1KWQ A;  1Z93 A;  1EOU A;  2GEH A;  2CBE A;  1G6V A;  1CRA A;  1V9E A;  2WEH A;  3M5T A;  1XPZ A;  1ZE8 A;  3KIG A;  2NXT A;  3MHC A;  3FE4 A;  2ABE A;  3IEO A;  3GZ0 A;  3D8W A;  2Q1B A;  1CNG A;  1AZM A;  1TG3 A;  1LGD A;  1FQM A;  1FSR A;  3DV7 A;  3M2N A;  8CA2 A;  1RZE A;  2FMG A;  2IT4 A;  1HCB A;  1CVD A;  3CZV A;  2CBC A;  2FOQ A;  1YDA A;  3HFP A;  2FOU A; 
#chains in the KnotProt database with same CATH homology
 3DC9 A;  1TEU X;  5CA2 A;  1CNX A;  1I9P A;  1I9Q A;  1RJ6 A;  1BNW A;  2HFX A;  1YO2 A;  3DD8 A;  2POU A;  1RZD A;  2NWY A;  1HUH A;  2HFW A;  1KOQ A;  1RJ5 A;  3ML2 A;  2NXR A;  1AM6 A;  3MNJ A;  1RAZ A;  3KWA A;  3IQK A;  3KS3 A;  3MNK A;  3BL1 A;  2FNK A;  3BET A;  3NJ9 A;  1YDB A;  1HED A;  1IF7 A;  1RZC A;  1LUG A;  1HEB A;  3N3J A;  3MNA A;  1UGF A;  2WEO A;  1CAL A;  3IBN A;  2HL4 A;  2NWO A;  1V9I C;  1TH9 A;  1ZSB A;  1OQ5 A;  1G4J A;  1CNC A;  1FR4 A;  2NWP A;  2NNS A;  2H15 A;  1I9M A;  2EU2 A;  2FOS A;  2NNV A;  1KWR A;  2X7S A;  1KOP A;  2NNO A;  1CNH A;  1T9N A;  2POW A;  2Q38 A;  1HVA A;  1IF8 A;  3IBI A;  1BZM A;  1LZV A;  1CAZ A;  1IF4 A;  3M5E A;  3EFI A;  3BL0 A;  1TG9 A;  9CA2 A;  2CBB A;  3OKV A;  1G48 A;  1I9N A;  2VVB X;  1FQL A;  3N2P A;  3DCS A;  1LG5 A;  1A42 A;  3JXG A;  2HFY A;  2OSF A;  1CVA A;  1FQN A;  3M5S A;  1CCU A;  3B1B A;  2FNM A;  1RZA A;  3HKN A;  1BN4 A;  3M67 A;  3MHL A;  3M40 A;  2CA2 A;  3FW3 A;  3M2Y A;  3KON A;  1HEA A;  1CVF A;  1I9O A;  3D0N A;  1FSN A;  2ZNC A;  1BN1 A;  2FW4 A;  3IGP A;  1BN3 A;  1CNW A;  1RAY A;  3MHO A;  1BCD A;  1G53 A;  1YO0 A;  3F4X A;  3MNU A;  1CAN A;  3L14 A;  2WEJ A;  1UGA A;  3JXF A;  2NNG A;  3NI5 A;  3OIK A;  3PO6 A;  2VVA X;  2AX2 A;  2POV A;  3P4V A;  2FNN A;  2WD2 A;  1CVE A;  1HEC A;  3PYK A;  3HKT A;  3D92 A;  3HLJ A;  1G0F A;  2EZ7 A;  3N4B A;  3D93 A;  3HKQ A;  1J9W A;  3HS4 A;  3MHM A;  4CA2 A;  1HUG A;  2O4Z A;  1BNT A;  3IBU A;  1RZB A;  2GD8 A;  2AW1 A;  1UGB A;  3KOK A;  1URT A;  1OKM A;  3IAI A;  3N0N A;  1I8Z A;  1JV0 A;  3R16 A;  3MNH A;  5CAC A;  1IF5 A;  1CAO A;  3M98 A;  3DC3 A;  1DMY A;  3DA2 A;  1G0E A;  3MDZ A;  2CBA A;  2F14 A;  1CIN A;  1IF9 A;  1CAI A;  3MWO A;  1CAK A;  1BIC A;  3CA2 A;  1CA2 A;  1CA3 A;  3FFP X;  3MHI A;  3IBL A;  1LG6 A;  3CAJ A;  1G52 A;  3DCW A;  1CVC A;  1G4O A;  2W2J A;  3DCC A;  2NN1 A;  1CIM A;  1CCS A;  3MYQ A;  1JD0 A;  1FR7 A;  3DAZ A;  2X7T A;  3MNI A;  3OKU A;  2Q1Q A;  1ZNC A;  1CCT A;  1I90 A;  1H4N A;  3K2F A;  1BNU A;  1BNV A;  1KEQ A;  3M96 A;  1H9Q A;  3OIM A;  1TBT X;  3F7U A;  1BNN A;  6CA2 A;  7CA2 A;  3F8E A;  3K7K A;  2NXS A;  3F7B A;  2NN7 A;  2ILI A;  1YO1 A;  1CNI A;  2OSM A;  1H9N A;  1CNJ A;  1ZSC A;  3DVC A;  1XEG A;  2EU3 A;  3KKX A;  3ML5 A;  1OKN A;  1F2W A;  3OIL A;  3B4F A;  1CAM A;  1I91 A;  2WD3 A;  3K34 A;  3DVD A;  1BV3 A;  1IF6 A;  1DCB A;  2WEG A;  3JXH C;  3M1J A;  1CIL A;  2NWZ A;  1UGE A;  1DCA A;  1CAY A;  1CAJ A;  1UGD A;  1THK A;  3D9Z A;  3M1W A;  2HD6 A;  2CBD A;  3MZC A;  1CNY A;  2HOC A;  3M1Q A;  1CVH A;  2CAB A;  2X7U A;  1MUA A;  1I9L A;  1HCA A;  1Y7W A;  1BNQ A;  12CA A;  1AVN A;  3DD0 A;  1CRM A;  3LXE A;  2NMX A;  1G46 A;  1YDD A;  3R17 B;  1G1D A;  3C7P A;  3ZNC A;  3M2Z A;  3DVB A;  1XEV A;  1BNM A;  1TTM A;  4CAC A;  1FSQ A;  2HKK A;  1XQ0 A;  1CVB A;  1TE3 X;  1Z97 A;  1FQR A;  1ZSA A;  3MMF A;  1FLJ A;  1G3Z A;  3M3X A;  1CAH A;  3HKU A;  3DBU A;  3EFT A;  2HNC A;  2FMZ A;  1G45 A;  1CZM A;  1YDC A;  1KWQ A;  1Z93 A;  1EOU A;  2GEH A;  2CBE A;  1G6V A;  1CRA A;  1V9E A;  2WEH A;  3M5T A;  1XPZ A;  1ZE8 A;  3KIG A;  2NXT A;  3MHC A;  3FE4 A;  2ABE A;  3IEO A;  3GZ0 A;  3D8W A;  2Q1B A;  1CNG A;  1AZM A;  1TG3 A;  1LGD A;  1FQM A;  1FSR A;  3DV7 A;  3M2N A;  8CA2 A;  1RZE A;  2FMG A;  2IT4 A;  1HCB A;  1CVD A;  3CZV A;  2CBC A;  2FOQ A;  1YDA A;  3HFP A;  2FOU A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling