1CCUA

Structure-assisted redesign of a protein-zinc binding site with femtomolar affinity
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 19-253 235 254-256 1-2 3-18 2 2 slipknot
Chain Sequence
WGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLHTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 3x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 22-252 231 253-256 1-2 3-21 2 3 slipknot
Fingerprint Knot forming loop Loop type
K +31 Trp5 ... His94 <->
Bridging ionZn262
<-> His96 ...
Chain closurePhe260 <-> Trp5
probabilistic
K +31 Trp5 ... His96 <->
Bridging ionZn262
<-> His119 ...
Chain closurePhe260 <-> Trp5
probabilistic
K +31 Trp5 ... His94 <->
Bridging ionZn262
<-> His119 ...
Chain closurePhe260 <-> Trp5
probabilistic
Chain Sequence
WGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLHTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 22-250 229 1-21, 251-255 21 5 knot
view details
3.1 23-253 231 254-255 1-21 22-22 21 1 slipknot
sequence length 255
structure length 255
publication title Structure-assisted redesign of a protein-zinc-binding site with femtomolar affinity.
pubmed doi rcsb
molecule tags Lyase (oxo-acid)
molecule keywords CARBONIC ANHYDRASE II
source organism Homo sapiens
total genus Genus: 73
ec nomenclature ec 4.2.1.1: Carbonate dehydratase.
pdb deposition date 1994-12-09
KnotProt deposition date 2018-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Carbonic Anhydrase II 1ccuA00
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Carbonic Anhydrase II 1ccuA00
3M96A 1G4OA 1CVCA 6CA2A 1KWQA 1BV3A 3HKQA 3MDZA 3DAZA 3D8WA 1CNCA 1KOQA 1LZVA 1H9QA 3HKUA 1THKA 8CA2A 3MHIA 1V9IC 1BNWA 3KOKA 3MNUA 2FNNA 3DD0A 3M2ZA 1YDAA 2NN7A 1LG5A 2WEHA 3JXFA 1UGAA 2NNVA 1RZEA 3DD8A 2WEJA 3DVBA 1IF7A 1J9WA 1UGFA 1XPZA 3KWAA 2X7SA 1TEUX 1I90A 1DCAA 3HLJA 1YDBA 3PO6A 1UGEA 3JXGA 3F8EA 1BNQA 1V9EA 3M67A 2AX2A 2ABEA 2CBCA 2EZ7A 3IBLA 1CNJA 1JV0A 1AZMA 3MNJA 3P4VA 1RZCA 5CA2A 3DA2A 1Z97A 2NNGA 3F4XA 1CNGA 3ML5A 1G3ZA 3DC9A 1CVAA 3DCCA 3NJ9A 1KEQA 2F14A 3KONA 3HFPA 1RJ5A 3HKNA 2NN1A 2H15A 1OQ5A 1A42A 2O4ZA 1RJ6A 1FR4A 1TTMA 2WEGA 2WEOA 3ZNCA 1CAKA 1CILA 1CCUA 3LXEA 1G0FA 1CZMA 1BN1A 1G6VA 1CA3A 2ILIA 3HS4A 1G4JA 2CABA 2W2JA 3BL0A 1I9OA 1G1DA 1CIMA 4CA2A 1HEDA 3MNIA 1HECA 1BICA 2FNMA 3MNHA 1YO0A 3N3JA 3R17B 2NMXA 3IQKA 2WD2A 2EU2A 1KWRA 1CALA 2POUA 1TH9A 2FMGA 1UGDA 3M5EA 2POVA 3M1WA 3N4BA 1IF6A 2X7TA 1CNXA 1CVBA 1LG6A 12CAA 1CNIA 3D93A 2NXSA 1DCBA 2HKKA 1BNVA 1CVFA 3IEOA 1H9NA 3N0NA 2FNKA 1G0EA 1IF4A 1ZSBA 1AVNA 3CZVA 3MWOA 3MHCA 1URTA 3L14A 1CANA 1YO2A 2ZNCA 3M1JA 1I9MA 1G52A 1BN4A 1CCSA 2NNSA 3MHMA 1XQ0A 2HFYA 3MNAA 1I9PA 1HVAA 1I9QA 2CBBA 3N2PA 3MHOA 3M2NA 1CINA 1ZE8A 2CA2A 3M3XA 1OKMA 3B4FA 1Z93A 2FOQA 1I91A 1FSQA 3EFIA 3OIMA 1I8ZA 7CA2A 1HCBA 1IF8A 3K2FA 1FQMA 2HFWA 1RZDA 2AW1A 3OIKA 2Q38A 1FQNA 1DMYA 3IBNA 1OKNA 2FOSA 3IGPA 1TBTX 2HNCA 3ML2A 3D0NA 3NI5A 1TE3X 2IT4A 1JD0A 3DC3A 3FFPX 1BNTA 2NWPA 3BL1A 1FSRA 1I9NA 1ZSAA 1CVHA 2Q1BA 2FOUA 2GEHA 1RAZA 3M5TA 1FLJA 1CAIA 1TG3A 2VVAX 2Q1QA 1TG9A 3IAIA 3DVDA 1RAYA 1RZAA 3D9ZA 2POWA 3KS3A 1CAMA 1YO1A 1ZSCA 2NWYA 1CRAA 3B1BA 3PYKA 2X7UA 2EU3A 1FR7A 1G45A 2HD6A 3MMFA 1BZMA 3IBUA 1HEAA 1F2WA 1ZNCA 1CAZA 3OKVA 2NNOA 4CACA 2OSFA 1BNMA 1HUHA 3C7PA 3F7BA 3F7UA 3MYQA 1HEBA 1CRMA 1LUGA 1IF9A 3DBUA 1Y7WA 3OILA 1YDCA 1AM6A 1YDDA 3K7KA 2OSMA 1CCTA 3DV7A 3FW3A 2CBAA 3CAJA 1CNWA 1FQRA 1EOUA 2VVBX 1BCDA 1IF5A 3R16A 1CAJA 3JXHC 3CA2A 3D92A 1LGDA 2HFXA 3M40A 1I9LA 1CNYA 3DVCA 1G46A 3KIGA 1UGBA 3M5SA 3IBIA 3MHLA 1RZBA 1FQLA 3BETA 2CBEA 3OKUA 2HOCA 1BN3A 5CACA 2FMZA 4PYYA 2FW4A 1FSNA 2HL4A 2NWZA 1G53A 1HUGA 3M98A 1XEGA 3GZ0A 9CA2A 3EFTA 1T9NA 1CAHA 1HCAA 3K34A 2NWOA 1CVEA 1CNHA 3MZCA 1CVDA 2WD3A 3DCWA 2NXTA 1BNUA 3MNKA 2NXRA 3HKTA 3M2YA 1BNNA 1H4NA 1XEVA 1MUAA 3DCSA 1CA2A 3FE4A 1CAOA 1CAYA 1KOPA 3M1QA 1G48A 2CBDA 3KKXA 2GD8A
chains in the KnotProt database with same CATH superfamily
3M96A 1G4OA 1CVCA 6CA2A 1KWQA 1BV3A 3HKQA 3MDZA 3DAZA 3D8WA 1CNCA 1KOQA 1LZVA 1H9QA 3HKUA 1THKA 8CA2A 3MHIA 1V9IC 1BNWA 3KOKA 3MNUA 2FNNA 3DD0A 3M2ZA 1YDAA 2NN7A 1LG5A 2WEHA 3JXFA 1UGAA 2NNVA 1RZEA 3DD8A 2WEJA 3DVBA 1IF7A 1J9WA 1UGFA 1XPZA 3KWAA 2X7SA 1TEUX 1I90A 1DCAA 3HLJA 1YDBA 3PO6A 1UGEA 3JXGA 3F8EA 1BNQA 1V9EA 3M67A 2AX2A 2ABEA 2CBCA 2EZ7A 3IBLA 1CNJA 1JV0A 1AZMA 3MNJA 3P4VA 1RZCA 5CA2A 3DA2A 1Z97A 2NNGA 3F4XA 1CNGA 3ML5A 1G3ZA 3DC9A 1CVAA 3DCCA 3NJ9A 1KEQA 2F14A 3KONA 3HFPA 1RJ5A 3HKNA 2NN1A 2H15A 1OQ5A 1A42A 2O4ZA 1RJ6A 1FR4A 1TTMA 2WEGA 2WEOA 3ZNCA 1CAKA 1CILA 1CCUA 3LXEA 1G0FA 1CZMA 1BN1A 1G6VA 1CA3A 2ILIA 3HS4A 1G4JA 2CABA 2W2JA 3BL0A 1I9OA 1G1DA 1CIMA 4CA2A 1HEDA 3MNIA 1HECA 1BICA 2FNMA 3MNHA 1YO0A 3N3JA 3R17B 2NMXA 3IQKA 2WD2A 2EU2A 1KWRA 1CALA 2POUA 1TH9A 2FMGA 1UGDA 3M5EA 2POVA 3M1WA 3N4BA 1IF6A 2X7TA 1CNXA 1CVBA 1LG6A 12CAA 1CNIA 3D93A 2NXSA 1DCBA 2HKKA 1BNVA 1CVFA 3IEOA 1H9NA 3N0NA 2FNKA 1G0EA 1IF4A 1ZSBA 1AVNA 3CZVA 3MWOA 3MHCA 1URTA 3L14A 1CANA 1YO2A 2ZNCA 3M1JA 1I9MA 1G52A 1BN4A 1CCSA 2NNSA 3MHMA 1XQ0A 2HFYA 3MNAA 1I9PA 1HVAA 1I9QA 2CBBA 3N2PA 3MHOA 3M2NA 1CINA 1ZE8A 2CA2A 3M3XA 1OKMA 3B4FA 1Z93A 2FOQA 1I91A 1FSQA 3EFIA 3OIMA 1I8ZA 7CA2A 1HCBA 1IF8A 3K2FA 1FQMA 2HFWA 1RZDA 2AW1A 3OIKA 2Q38A 1FQNA 1DMYA 3IBNA 1OKNA 2FOSA 3IGPA 1TBTX 2HNCA 3ML2A 3D0NA 3NI5A 1TE3X 2IT4A 1JD0A 3DC3A 3FFPX 1BNTA 2NWPA 3BL1A 1FSRA 1I9NA 1ZSAA 1CVHA 2Q1BA 2FOUA 2GEHA 1RAZA 3M5TA 1FLJA 1CAIA 1TG3A 2VVAX 2Q1QA 1TG9A 3IAIA 3DVDA 1RAYA 1RZAA 3D9ZA 2POWA 3KS3A 1CAMA 1YO1A 1ZSCA 2NWYA 1CRAA 3B1BA 3PYKA 2X7UA 2EU3A 1FR7A 1G45A 2HD6A 3MMFA 1BZMA 3IBUA 1HEAA 1F2WA 1ZNCA 1CAZA 3OKVA 2NNOA 4CACA 2OSFA 1BNMA 1HUHA 3C7PA 3F7BA 3F7UA 3MYQA 1HEBA 1CRMA 1LUGA 1IF9A 3DBUA 1Y7WA 3OILA 1YDCA 1AM6A 1YDDA 3K7KA 2OSMA 1CCTA 3DV7A 3FW3A 2CBAA 3CAJA 1CNWA 1FQRA 1EOUA 2VVBX 1BCDA 1IF5A 3R16A 1CAJA 3JXHC 3CA2A 3D92A 1LGDA 2HFXA 3M40A 1I9LA 1CNYA 3DVCA 1G46A 3KIGA 1UGBA 3M5SA 3IBIA 3MHLA 1RZBA 1FQLA 3BETA 2CBEA 3OKUA 2HOCA 1BN3A 5CACA 2FMZA 4PYYA 2FW4A 1FSNA 2HL4A 2NWZA 1G53A 1HUGA 3M98A 1XEGA 3GZ0A 9CA2A 3EFTA 1T9NA 1CAHA 1HCAA 3K34A 2NWOA 1CVEA 1CNHA 3MZCA 1CVDA 2WD3A 3DCWA 2NXTA 1BNUA 3MNKA 2NXRA 3HKTA 3M2YA 1BNNA 1H4NA 1XEVA 1MUAA 3DCSA 1CA2A 3FE4A 1CAOA 1CAYA 1KOPA 3M1QA 1G48A 2CBDA 3KKXA 2GD8A
chains in the KnotProt database with same CATH topology
3M96A 1G4OA 1CVCA 6CA2A 1KWQA 1BV3A 3HKQA 3MDZA 3DAZA 3D8WA 1CNCA 1KOQA 1LZVA 1H9QA 3HKUA 1THKA 8CA2A 3MHIA 1V9IC 1BNWA 3KOKA 3MNUA 2FNNA 3DD0A 3M2ZA 1YDAA 2NN7A 1LG5A 2WEHA 3JXFA 1UGAA 2NNVA 1RZEA 3DD8A 2WEJA 3DVBA 1IF7A 1J9WA 1UGFA 1XPZA 3KWAA 2X7SA 1TEUX 1I90A 1DCAA 3HLJA 1YDBA 3PO6A 1UGEA 3JXGA 3F8EA 1BNQA 1V9EA 3M67A 2AX2A 2ABEA 2CBCA 2EZ7A 3IBLA 1CNJA 1JV0A 1AZMA 3MNJA 3P4VA 1RZCA 5CA2A 3DA2A 1Z97A 2NNGA 3F4XA 1CNGA 3ML5A 1G3ZA 3DC9A 1CVAA 3DCCA 3NJ9A 1KEQA 2F14A 3KONA 3HFPA 1RJ5A 3HKNA 2NN1A 2H15A 1OQ5A 1A42A 2O4ZA 1RJ6A 1FR4A 1TTMA 2WEGA 2WEOA 3ZNCA 1CAKA 1CILA 1CCUA 3LXEA 1G0FA 1CZMA 1BN1A 1G6VA 1CA3A 2ILIA 3HS4A 1G4JA 2CABA 2W2JA 3BL0A 1I9OA 1G1DA 1CIMA 4CA2A 1HEDA 3MNIA 1HECA 1BICA 2FNMA 3MNHA 1YO0A 3N3JA 3R17B 2NMXA 3IQKA 2WD2A 2EU2A 1KWRA 1CALA 2POUA 1TH9A 2FMGA 1UGDA 3M5EA 2POVA 3M1WA 3N4BA 1IF6A 2X7TA 1CNXA 1CVBA 1LG6A 12CAA 1CNIA 3D93A 2NXSA 1DCBA 2HKKA 1BNVA 1CVFA 3IEOA 1H9NA 3N0NA 2FNKA 1G0EA 1IF4A 1ZSBA 1AVNA 3CZVA 3MWOA 3MHCA 1URTA 3L14A 1CANA 1YO2A 2ZNCA 3M1JA 1I9MA 1G52A 1BN4A 1CCSA 2NNSA 3MHMA 1XQ0A 2HFYA 3MNAA 1I9PA 1HVAA 1I9QA 2CBBA 3N2PA 3MHOA 3M2NA 1CINA 1ZE8A 2CA2A 3M3XA 1OKMA 3B4FA 1Z93A 2FOQA 1I91A 1FSQA 3EFIA 3OIMA 1I8ZA 7CA2A 1HCBA 1IF8A 3K2FA 1FQMA 2HFWA 1RZDA 2AW1A 3OIKA 2Q38A 1FQNA 1DMYA 3IBNA 1OKNA 2FOSA 3IGPA 1TBTX 2HNCA 3ML2A 3D0NA 3NI5A 1TE3X 2IT4A 1JD0A 3DC3A 3FFPX 1BNTA 2NWPA 3BL1A 1FSRA 1I9NA 1ZSAA 1CVHA 2Q1BA 2FOUA 2GEHA 1RAZA 3M5TA 1FLJA 1CAIA 1TG3A 2VVAX 2Q1QA 1TG9A 3IAIA 3DVDA 1RAYA 1RZAA 3D9ZA 2POWA 3KS3A 1CAMA 1YO1A 1ZSCA 2NWYA 1CRAA 3B1BA 3PYKA 2X7UA 2EU3A 1FR7A 1G45A 2HD6A 3MMFA 1BZMA 3IBUA 1HEAA 1F2WA 1ZNCA 1CAZA 3OKVA 2NNOA 4CACA 2OSFA 1BNMA 1HUHA 3C7PA 3F7BA 3F7UA 3MYQA 1HEBA 1CRMA 1LUGA 1IF9A 3DBUA 1Y7WA 3OILA 1YDCA 1AM6A 1YDDA 3K7KA 2OSMA 1CCTA 3DV7A 3FW3A 2CBAA 3CAJA 1CNWA 1FQRA 1EOUA 2VVBX 1BCDA 1IF5A 3R16A 1CAJA 3JXHC 3CA2A 3D92A 1LGDA 2HFXA 3M40A 1I9LA 1CNYA 3DVCA 1G46A 3KIGA 1UGBA 3M5SA 3IBIA 3MHLA 1RZBA 1FQLA 3BETA 2CBEA 3OKUA 2HOCA 1BN3A 5CACA 2FMZA 2FW4A 1FSNA 2HL4A 2NWZA 1G53A 1HUGA 3M98A 1XEGA 3GZ0A 9CA2A 3EFTA 1T9NA 1CAHA 1HCAA 3K34A 2NWOA 1CVEA 1CNHA 3MZCA 1CVDA 2WD3A 3DCWA 2NXTA 1BNUA 3MNKA 2NXRA 3HKTA 3M2YA 1BNNA 1H4NA 1XEVA 1MUAA 3DCSA 1CA2A 3FE4A 1CAOA 1CAYA 1KOPA 3M1QA 1G48A 2CBDA 3KKXA 2GD8A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3M96 A;  1G4O A;  1CVC A;  6CA2 A;  1KWQ A;  1BV3 A;  3HKQ A;  3MDZ A;  3DAZ A;  3D8W A;  1CNC A;  1KOQ A;  1LZV A;  1H9Q A;  3HKU A;  1THK A;  8CA2 A;  3MHI A;  1V9I C;  1BNW A;  3KOK A;  3MNU A;  2FNN A;  3DD0 A;  3M2Z A;  1YDA A;  2NN7 A;  1LG5 A;  2WEH A;  3JXF A;  1UGA A;  2NNV A;  1RZE A;  3DD8 A;  2WEJ A;  3DVB A;  1IF7 A;  1J9W A;  1UGF A;  1XPZ A;  3KWA A;  2X7S A;  1TEU X;  1I90 A;  1DCA A;  3HLJ A;  1YDB A;  3PO6 A;  1UGE A;  3JXG A;  3F8E A;  1BNQ A;  1V9E A;  3M67 A;  2AX2 A;  2ABE A;  2CBC A;  2EZ7 A;  3IBL A;  1CNJ A;  1JV0 A;  1AZM A;  3MNJ A;  3P4V A;  1RZC A;  5CA2 A;  3DA2 A;  1Z97 A;  2NNG A;  3F4X A;  1CNG A;  3ML5 A;  1G3Z A;  3DC9 A;  1CVA A;  3DCC A;  3NJ9 A;  1KEQ A;  2F14 A;  3KON A;  3HFP A;  1RJ5 A;  3HKN A;  2NN1 A;  2H15 A;  1OQ5 A;  1A42 A;  2O4Z A;  1RJ6 A;  1FR4 A;  1TTM A;  2WEG A;  2WEO A;  3ZNC A;  1CAK A;  1CIL A;  1CCU A;  3LXE A;  1G0F A;  1CZM A;  1BN1 A;  1G6V A;  1CA3 A;  2ILI A;  3HS4 A;  1G4J A;  2CAB A;  2W2J A;  3BL0 A;  1I9O A;  1G1D A;  1CIM A;  4CA2 A;  1HED A;  3MNI A;  1HEC A;  1BIC A;  2FNM A;  3MNH A;  1YO0 A;  3N3J A;  3R17 B;  2NMX A;  3IQK A;  2WD2 A;  2EU2 A;  1KWR A;  1CAL A;  2POU A;  1TH9 A;  2FMG A;  1UGD A;  3M5E A;  2POV A;  3M1W A;  3N4B A;  1IF6 A;  2X7T A;  1CNX A;  1CVB A;  1LG6 A;  12CA A;  1CNI A;  3D93 A;  2NXS A;  1DCB A;  2HKK A;  1BNV A;  1CVF A;  3IEO A;  1H9N A;  3N0N A;  2FNK A;  1G0E A;  1IF4 A;  1ZSB A;  1AVN A;  3CZV A;  3MWO A;  3MHC A;  1URT A;  3L14 A;  1CAN A;  1YO2 A;  2ZNC A;  3M1J A;  1I9M A;  1G52 A;  1BN4 A;  1CCS A;  2NNS A;  3MHM A;  1XQ0 A;  2HFY A;  3MNA A;  1I9P A;  1HVA A;  1I9Q A;  2CBB A;  3N2P A;  3MHO A;  3M2N A;  1CIN A;  1ZE8 A;  2CA2 A;  3M3X A;  1OKM A;  3B4F A;  1Z93 A;  2FOQ A;  1I91 A;  1FSQ A;  3EFI A;  3OIM A;  1I8Z A;  7CA2 A;  1HCB A;  1IF8 A;  3K2F A;  1FQM A;  2HFW A;  1RZD A;  2AW1 A;  3OIK A;  2Q38 A;  1FQN A;  1DMY A;  3IBN A;  1OKN A;  2FOS A;  3IGP A;  1TBT X;  2HNC A;  3ML2 A;  3D0N A;  3NI5 A;  1TE3 X;  2IT4 A;  1JD0 A;  3DC3 A;  3FFP X;  1BNT A;  2NWP A;  3BL1 A;  1FSR A;  1I9N A;  1ZSA A;  1CVH A;  2Q1B A;  2FOU A;  2GEH A;  1RAZ A;  3M5T A;  1FLJ A;  1CAI A;  1TG3 A;  2VVA X;  2Q1Q A;  1TG9 A;  3IAI A;  3DVD A;  1RAY A;  1RZA A;  3D9Z A;  2POW A;  3KS3 A;  1CAM A;  1YO1 A;  1ZSC A;  2NWY A;  1CRA A;  3B1B A;  3PYK A;  2X7U A;  2EU3 A;  1FR7 A;  1G45 A;  2HD6 A;  3MMF A;  1BZM A;  3IBU A;  1HEA A;  1F2W A;  1ZNC A;  1CAZ A;  3OKV A;  2NNO A;  4CAC A;  2OSF A;  1BNM A;  1HUH A;  3C7P A;  3F7B A;  3F7U A;  3MYQ A;  1HEB A;  1CRM A;  1LUG A;  1IF9 A;  3DBU A;  1Y7W A;  3OIL A;  1YDC A;  1AM6 A;  1YDD A;  3K7K A;  2OSM A;  1CCT A;  3DV7 A;  3FW3 A;  2CBA A;  3CAJ A;  1CNW A;  1FQR A;  1EOU A;  2VVB X;  1BCD A;  1IF5 A;  3R16 A;  1CAJ A;  3JXH C;  3CA2 A;  3D92 A;  1LGD A;  2HFX A;  3M40 A;  1I9L A;  1CNY A;  3DVC A;  1G46 A;  3KIG A;  1UGB A;  3M5S A;  3IBI A;  3MHL A;  1RZB A;  1FQL A;  3BET A;  2CBE A;  3OKU A;  2HOC A;  1BN3 A;  5CAC A;  2FMZ A;  4PYY A;  2FW4 A;  1FSN A;  2HL4 A;  2NWZ A;  1G53 A;  1HUG A;  3M98 A;  1XEG A;  3GZ0 A;  9CA2 A;  3EFT A;  1T9N A;  1CAH A;  1HCA A;  3K34 A;  2NWO A;  1CVE A;  1CNH A;  3MZC A;  1CVD A;  2WD3 A;  3DCW A;  2NXT A;  1BNU A;  3MNK A;  2NXR A;  3HKT A;  3M2Y A;  1BNN A;  1H4N A;  1XEV A;  1MUA A;  3DCS A;  1CA2 A;  3FE4 A;  1CAO A;  1CAY A;  1KOP A;  3M1Q A;  1G48 A;  2CBD A;  3KKX A;  2GD8 A; 
#chains in the KnotProt database with same CATH topology
 3M96 A;  1G4O A;  1CVC A;  6CA2 A;  1KWQ A;  1BV3 A;  3HKQ A;  3MDZ A;  3DAZ A;  3D8W A;  1CNC A;  1KOQ A;  1LZV A;  1H9Q A;  3HKU A;  1THK A;  8CA2 A;  3MHI A;  1V9I C;  1BNW A;  3KOK A;  3MNU A;  2FNN A;  3DD0 A;  3M2Z A;  1YDA A;  2NN7 A;  1LG5 A;  2WEH A;  3JXF A;  1UGA A;  2NNV A;  1RZE A;  3DD8 A;  2WEJ A;  3DVB A;  1IF7 A;  1J9W A;  1UGF A;  1XPZ A;  3KWA A;  2X7S A;  1TEU X;  1I90 A;  1DCA A;  3HLJ A;  1YDB A;  3PO6 A;  1UGE A;  3JXG A;  3F8E A;  1BNQ A;  1V9E A;  3M67 A;  2AX2 A;  2ABE A;  2CBC A;  2EZ7 A;  3IBL A;  1CNJ A;  1JV0 A;  1AZM A;  3MNJ A;  3P4V A;  1RZC A;  5CA2 A;  3DA2 A;  1Z97 A;  2NNG A;  3F4X A;  1CNG A;  3ML5 A;  1G3Z A;  3DC9 A;  1CVA A;  3DCC A;  3NJ9 A;  1KEQ A;  2F14 A;  3KON A;  3HFP A;  1RJ5 A;  3HKN A;  2NN1 A;  2H15 A;  1OQ5 A;  1A42 A;  2O4Z A;  1RJ6 A;  1FR4 A;  1TTM A;  2WEG A;  2WEO A;  3ZNC A;  1CAK A;  1CIL A;  1CCU A;  3LXE A;  1G0F A;  1CZM A;  1BN1 A;  1G6V A;  1CA3 A;  2ILI A;  3HS4 A;  1G4J A;  2CAB A;  2W2J A;  3BL0 A;  1I9O A;  1G1D A;  1CIM A;  4CA2 A;  1HED A;  3MNI A;  1HEC A;  1BIC A;  2FNM A;  3MNH A;  1YO0 A;  3N3J A;  3R17 B;  2NMX A;  3IQK A;  2WD2 A;  2EU2 A;  1KWR A;  1CAL A;  2POU A;  1TH9 A;  2FMG A;  1UGD A;  3M5E A;  2POV A;  3M1W A;  3N4B A;  1IF6 A;  2X7T A;  1CNX A;  1CVB A;  1LG6 A;  12CA A;  1CNI A;  3D93 A;  2NXS A;  1DCB A;  2HKK A;  1BNV A;  1CVF A;  3IEO A;  1H9N A;  3N0N A;  2FNK A;  1G0E A;  1IF4 A;  1ZSB A;  1AVN A;  3CZV A;  3MWO A;  3MHC A;  1URT A;  3L14 A;  1CAN A;  1YO2 A;  2ZNC A;  3M1J A;  1I9M A;  1G52 A;  1BN4 A;  1CCS A;  2NNS A;  3MHM A;  1XQ0 A;  2HFY A;  3MNA A;  1I9P A;  1HVA A;  1I9Q A;  2CBB A;  3N2P A;  3MHO A;  3M2N A;  1CIN A;  1ZE8 A;  2CA2 A;  3M3X A;  1OKM A;  3B4F A;  1Z93 A;  2FOQ A;  1I91 A;  1FSQ A;  3EFI A;  3OIM A;  1I8Z A;  7CA2 A;  1HCB A;  1IF8 A;  3K2F A;  1FQM A;  2HFW A;  1RZD A;  2AW1 A;  3OIK A;  2Q38 A;  1FQN A;  1DMY A;  3IBN A;  1OKN A;  2FOS A;  3IGP A;  1TBT X;  2HNC A;  3ML2 A;  3D0N A;  3NI5 A;  1TE3 X;  2IT4 A;  1JD0 A;  3DC3 A;  3FFP X;  1BNT A;  2NWP A;  3BL1 A;  1FSR A;  1I9N A;  1ZSA A;  1CVH A;  2Q1B A;  2FOU A;  2GEH A;  1RAZ A;  3M5T A;  1FLJ A;  1CAI A;  1TG3 A;  2VVA X;  2Q1Q A;  1TG9 A;  3IAI A;  3DVD A;  1RAY A;  1RZA A;  3D9Z A;  2POW A;  3KS3 A;  1CAM A;  1YO1 A;  1ZSC A;  2NWY A;  1CRA A;  3B1B A;  3PYK A;  2X7U A;  2EU3 A;  1FR7 A;  1G45 A;  2HD6 A;  3MMF A;  1BZM A;  3IBU A;  1HEA A;  1F2W A;  1ZNC A;  1CAZ A;  3OKV A;  2NNO A;  4CAC A;  2OSF A;  1BNM A;  1HUH A;  3C7P A;  3F7B A;  3F7U A;  3MYQ A;  1HEB A;  1CRM A;  1LUG A;  1IF9 A;  3DBU A;  1Y7W A;  3OIL A;  1YDC A;  1AM6 A;  1YDD A;  3K7K A;  2OSM A;  1CCT A;  3DV7 A;  3FW3 A;  2CBA A;  3CAJ A;  1CNW A;  1FQR A;  1EOU A;  2VVB X;  1BCD A;  1IF5 A;  3R16 A;  1CAJ A;  3JXH C;  3CA2 A;  3D92 A;  1LGD A;  2HFX A;  3M40 A;  1I9L A;  1CNY A;  3DVC A;  1G46 A;  3KIG A;  1UGB A;  3M5S A;  3IBI A;  3MHL A;  1RZB A;  1FQL A;  3BET A;  2CBE A;  3OKU A;  2HOC A;  1BN3 A;  5CAC A;  2FMZ A;  4PYY A;  2FW4 A;  1FSN A;  2HL4 A;  2NWZ A;  1G53 A;  1HUG A;  3M98 A;  1XEG A;  3GZ0 A;  9CA2 A;  3EFT A;  1T9N A;  1CAH A;  1HCA A;  3K34 A;  2NWO A;  1CVE A;  1CNH A;  3MZC A;  1CVD A;  2WD3 A;  3DCW A;  2NXT A;  1BNU A;  3MNK A;  2NXR A;  3HKT A;  3M2Y A;  1BNN A;  1H4N A;  1XEV A;  1MUA A;  3DCS A;  1CA2 A;  3FE4 A;  1CAO A;  1CAY A;  1KOP A;  3M1Q A;  1G48 A;  2CBD A;  3KKX A;  2GD8 A; 
#chains in the KnotProt database with same CATH homology
 3M96 A;  1G4O A;  1CVC A;  6CA2 A;  1KWQ A;  1BV3 A;  3HKQ A;  3MDZ A;  3DAZ A;  3D8W A;  1CNC A;  1KOQ A;  1LZV A;  1H9Q A;  3HKU A;  1THK A;  8CA2 A;  3MHI A;  1V9I C;  1BNW A;  3KOK A;  3MNU A;  2FNN A;  3DD0 A;  3M2Z A;  1YDA A;  2NN7 A;  1LG5 A;  2WEH A;  3JXF A;  1UGA A;  2NNV A;  1RZE A;  3DD8 A;  2WEJ A;  3DVB A;  1IF7 A;  1J9W A;  1UGF A;  1XPZ A;  3KWA A;  2X7S A;  1TEU X;  1I90 A;  1DCA A;  3HLJ A;  1YDB A;  3PO6 A;  1UGE A;  3JXG A;  3F8E A;  1BNQ A;  1V9E A;  3M67 A;  2AX2 A;  2ABE A;  2CBC A;  2EZ7 A;  3IBL A;  1CNJ A;  1JV0 A;  1AZM A;  3MNJ A;  3P4V A;  1RZC A;  5CA2 A;  3DA2 A;  1Z97 A;  2NNG A;  3F4X A;  1CNG A;  3ML5 A;  1G3Z A;  3DC9 A;  1CVA A;  3DCC A;  3NJ9 A;  1KEQ A;  2F14 A;  3KON A;  3HFP A;  1RJ5 A;  3HKN A;  2NN1 A;  2H15 A;  1OQ5 A;  1A42 A;  2O4Z A;  1RJ6 A;  1FR4 A;  1TTM A;  2WEG A;  2WEO A;  3ZNC A;  1CAK A;  1CIL A;  1CCU A;  3LXE A;  1G0F A;  1CZM A;  1BN1 A;  1G6V A;  1CA3 A;  2ILI A;  3HS4 A;  1G4J A;  2CAB A;  2W2J A;  3BL0 A;  1I9O A;  1G1D A;  1CIM A;  4CA2 A;  1HED A;  3MNI A;  1HEC A;  1BIC A;  2FNM A;  3MNH A;  1YO0 A;  3N3J A;  3R17 B;  2NMX A;  3IQK A;  2WD2 A;  2EU2 A;  1KWR A;  1CAL A;  2POU A;  1TH9 A;  2FMG A;  1UGD A;  3M5E A;  2POV A;  3M1W A;  3N4B A;  1IF6 A;  2X7T A;  1CNX A;  1CVB A;  1LG6 A;  12CA A;  1CNI A;  3D93 A;  2NXS A;  1DCB A;  2HKK A;  1BNV A;  1CVF A;  3IEO A;  1H9N A;  3N0N A;  2FNK A;  1G0E A;  1IF4 A;  1ZSB A;  1AVN A;  3CZV A;  3MWO A;  3MHC A;  1URT A;  3L14 A;  1CAN A;  1YO2 A;  2ZNC A;  3M1J A;  1I9M A;  1G52 A;  1BN4 A;  1CCS A;  2NNS A;  3MHM A;  1XQ0 A;  2HFY A;  3MNA A;  1I9P A;  1HVA A;  1I9Q A;  2CBB A;  3N2P A;  3MHO A;  3M2N A;  1CIN A;  1ZE8 A;  2CA2 A;  3M3X A;  1OKM A;  3B4F A;  1Z93 A;  2FOQ A;  1I91 A;  1FSQ A;  3EFI A;  3OIM A;  1I8Z A;  7CA2 A;  1HCB A;  1IF8 A;  3K2F A;  1FQM A;  2HFW A;  1RZD A;  2AW1 A;  3OIK A;  2Q38 A;  1FQN A;  1DMY A;  3IBN A;  1OKN A;  2FOS A;  3IGP A;  1TBT X;  2HNC A;  3ML2 A;  3D0N A;  3NI5 A;  1TE3 X;  2IT4 A;  1JD0 A;  3DC3 A;  3FFP X;  1BNT A;  2NWP A;  3BL1 A;  1FSR A;  1I9N A;  1ZSA A;  1CVH A;  2Q1B A;  2FOU A;  2GEH A;  1RAZ A;  3M5T A;  1FLJ A;  1CAI A;  1TG3 A;  2VVA X;  2Q1Q A;  1TG9 A;  3IAI A;  3DVD A;  1RAY A;  1RZA A;  3D9Z A;  2POW A;  3KS3 A;  1CAM A;  1YO1 A;  1ZSC A;  2NWY A;  1CRA A;  3B1B A;  3PYK A;  2X7U A;  2EU3 A;  1FR7 A;  1G45 A;  2HD6 A;  3MMF A;  1BZM A;  3IBU A;  1HEA A;  1F2W A;  1ZNC A;  1CAZ A;  3OKV A;  2NNO A;  4CAC A;  2OSF A;  1BNM A;  1HUH A;  3C7P A;  3F7B A;  3F7U A;  3MYQ A;  1HEB A;  1CRM A;  1LUG A;  1IF9 A;  3DBU A;  1Y7W A;  3OIL A;  1YDC A;  1AM6 A;  1YDD A;  3K7K A;  2OSM A;  1CCT A;  3DV7 A;  3FW3 A;  2CBA A;  3CAJ A;  1CNW A;  1FQR A;  1EOU A;  2VVB X;  1BCD A;  1IF5 A;  3R16 A;  1CAJ A;  3JXH C;  3CA2 A;  3D92 A;  1LGD A;  2HFX A;  3M40 A;  1I9L A;  1CNY A;  3DVC A;  1G46 A;  3KIG A;  1UGB A;  3M5S A;  3IBI A;  3MHL A;  1RZB A;  1FQL A;  3BET A;  2CBE A;  3OKU A;  2HOC A;  1BN3 A;  5CAC A;  2FMZ A;  2FW4 A;  1FSN A;  2HL4 A;  2NWZ A;  1G53 A;  1HUG A;  3M98 A;  1XEG A;  3GZ0 A;  9CA2 A;  3EFT A;  1T9N A;  1CAH A;  1HCA A;  3K34 A;  2NWO A;  1CVE A;  1CNH A;  3MZC A;  1CVD A;  2WD3 A;  3DCW A;  2NXT A;  1BNU A;  3MNK A;  2NXR A;  3HKT A;  3M2Y A;  1BNN A;  1H4N A;  1XEV A;  1MUA A;  3DCS A;  1CA2 A;  3FE4 A;  1CAO A;  1CAY A;  1KOP A;  3M1Q A;  1G48 A;  2CBD A;  3KKX A;  2GD8 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling