2CABA

Structure, refinement and function of carbonic anhydrase isozymes. refinement of human carbonic anhydrase i
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 24-254 231 255-256 1-2 3-23 2 1 slipknot
Chain Sequence
WGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNQDRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 3x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 21-253 233 1-20, 254-256 20 2 slipknot
Fingerprint Knot forming loop Loop type
K +31 Trp5 ... His94 <->
Bridging ionZn261
<-> His96 ...
Chain closurePhe260 <-> Trp5
probabilistic
K +31 Trp5 ... His96 <->
Bridging ionZn261
<-> His119 ...
Chain closurePhe260 <-> Trp5
probabilistic
K +31 Trp5 ... His94 <->
Bridging ionZn261
<-> His119 ...
Chain closurePhe260 <-> Trp5
probabilistic
Chain Sequence
WGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNQDRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 23-252 230 1-22, 253-256 22 4 knot
sequence length 256
structure length 256
publication title Structure, refinement, and function of carbonic anhydrase isozymes: refinement of human carbonic anhydrase I
pubmed rcsb
molecule tags Hydro-lyase
molecule keywords CARBONIC ANHYDRASE FORM B
source organism Homo sapiens
total genus Genus: 75
ec nomenclature ec 4.2.1.1: Carbonate dehydratase.
pdb deposition date 1983-10-05
KnotProt deposition date 2018-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Carbonic Anhydrase II 2cabA00
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Carbonic Anhydrase II 2cabA00
3MNJA 1G45A 3MDZA 1RZCA 2H15A 1KWRA 1H4NA 1I9QA 3DVCA 1ZNCA 2X7SA 3C7PA 3JXFA 1DMYA 1BV3A 2OSFA 3M5TA 2Q1BA 3M1QA 3B1BA 2HFWA 1V9EA 3D9ZA 1HECA 1BNWA 1CVAA 1UGDA 3MHLA 1MUAA 1Y7WA 2Q38A 1J9WA 2FNKA 1TH9A 3FW3A 3KIGA 4CACA 2NWYA 3DVBA 2HFXA 3LXEA 3D93A 2WEGA 2NXSA 1CVDA 1TG9A 2EZ7A 1AZMA 1BCDA 1HEBA 1FSNA 2NXRA 1YDCA 1I8ZA 1G0FA 1CIMA 2EU2A 1CAJA 3MHOA 3N2PA 3IQKA 3K34A 1I9LA 12CAA 2VVAX 3DC9A 2HFYA 3CAJA 1G1DA 2ABEA 3MNAA 1XEGA 2W2JA 1KOPA 3DCWA 3DV7A 1HUGA 1AVNA 2HOCA 3K2FA 3MZCA 1FSQA 3BETA 2AX2A 1CAZA 2ZNCA 1YDBA 3M1JA 3M3XA 3KKXA 3JXGA 2FNNA 2X7UA 1FR4A 3MNHA 3IBUA 1FR7A 1H9NA 2NNGA 1CNHA 1I9MA 1LZVA 1BN3A 1CAOA 3HKTA 1CVHA 3OKUA 2F14A 1CVCA 3MWOA 1CCUA 1Z93A 1CVFA 3D92A 1CVEA 1V9IC 1CRMA 4PYYA 3BL1A 1THKA 1URTA 1G4OA 2NNOA 1FLJA 1CNWA 2IT4A 1LGDA 2GD8A 3F8EA 1G53A 3M98A 2NNVA 5CACA 3MNUA 1RZEA 1JV0A 3BL0A 2NN1A 3KONA 2NWZA 2NN7A 3FE4A 2O4ZA 1G3ZA 3EFIA 2POUA 1XEVA 3DBUA 3R17B 3R16A 1IF9A 3CZVA 1DCBA 1FQMA 1BNVA 6CA2A 1CINA 1BNUA 1TG3A 1CAHA 2CA2A 1OKNA 3ML2A 1BICA 2WEHA 1EOUA 1CA3A 1G6VA 2NWPA 3DC3A 3OIKA 1BN1A 3B4FA 1IF6A 1FQRA 1CCTA 1BNMA 3HKNA 3IBNA 1BZMA 2X7TA 2NXTA 1CANA 1F2WA 3PYKA 3M96A 1I9OA 1LG5A 3M5SA 3HLJA 1RAZA 1G0EA 1IF7A 3L14A 3KS3A 3HKUA 2CBAA 2CBDA 9CA2A 1ZSCA 1UGEA 1IF5A 2WD2A 3F7BA 3HS4A 1CVBA 1HVAA 1G52A 3IBLA 1CRAA 3MHMA 2HL4A 2WEJA 3PO6A 3HFPA 1CA2A 3IAIA 3DVDA 3IBIA 2HKKA 1XQ0A 1ZE8A 1HCAA 1KOQA 7CA2A 1CAMA 1OQ5A 1TTMA 1FQNA 2CBCA 3NJ9A 1TEUX 3MNIA 3DD8A 2FW4A 3JXHC 1RAYA 2AW1A 3MHCA 3DA2A 3OIMA 1OKMA 1Z97A 1ZSAA 1UGBA 3ML5A 2HD6A 1H9QA 1CNGA 2WEOA 1G48A 1CAIA 1RZAA 1I90A 2NNSA 1BNQA 1FQLA 1I9PA 2CBEA 3M2YA 1A42A 1UGFA 3MMFA 1RZDA 1YDAA 1I9NA 1KWQA 2FNMA 2EU3A 3N0NA 2ILIA 1YO0A 1T9NA 3KWAA 1BN4A 1RZBA 3MHIA 2FMGA 3F7UA 3IEOA 1HEAA 1TBTX 1CZMA 3M67A 3F4XA 2CABA 3KOKA 3IGPA 1G4JA 8CA2A 2HNCA 3EFTA 1BNTA 3M1WA 1DCAA 1FSRA 3M40A 3CA2A 1HUHA 2OSMA 3DAZA 3P4VA 3GZ0A 2FMZA 2FOSA 3DCSA 3D0NA 1CNXA 1CAKA 1BNNA 2WD3A 1CNJA 1KEQA 2NMXA 1CNIA 1YDDA 1HEDA 1CCSA 2POVA 3N4BA 2GEHA 1IF8A 3M2ZA 3OILA 3ZNCA 3FFPX 3D8WA 1CILA 1TE3X 1YO1A 2Q1QA 1LG6A 3OKVA 3M5EA 3N3JA 1UGAA 3MNKA 1HCBA 3DD0A 1ZSBA 5CA2A 1LUGA 1AM6A 1CNCA 3HKQA 3M2NA 3NI5A 4CA2A 3K7KA 3DCCA 1RJ5A 2CBBA 3MYQA 1CAYA 2NWOA 1CALA 1G46A 1XPZA 1CNYA 2POWA 1YO2A 2VVBX 1IF4A 1JD0A 1I91A 2FOQA 2FOUA 1RJ6A
chains in the KnotProt database with same CATH superfamily
3MNJA 1G45A 3MDZA 1RZCA 2H15A 1KWRA 1H4NA 1I9QA 3DVCA 1ZNCA 2X7SA 3C7PA 3JXFA 1DMYA 1BV3A 2OSFA 3M5TA 2Q1BA 3M1QA 3B1BA 2HFWA 1V9EA 3D9ZA 1HECA 1BNWA 1CVAA 1UGDA 3MHLA 1MUAA 1Y7WA 2Q38A 1J9WA 2FNKA 1TH9A 3FW3A 3KIGA 4CACA 2NWYA 3DVBA 2HFXA 3LXEA 3D93A 2WEGA 2NXSA 1CVDA 1TG9A 2EZ7A 1AZMA 1BCDA 1HEBA 1FSNA 2NXRA 1YDCA 1I8ZA 1G0FA 1CIMA 2EU2A 1CAJA 3MHOA 3N2PA 3IQKA 3K34A 1I9LA 12CAA 2VVAX 3DC9A 2HFYA 3CAJA 1G1DA 2ABEA 3MNAA 1XEGA 2W2JA 1KOPA 3DCWA 3DV7A 1HUGA 1AVNA 2HOCA 3K2FA 3MZCA 1FSQA 3BETA 2AX2A 1CAZA 2ZNCA 1YDBA 3M1JA 3M3XA 3KKXA 3JXGA 2FNNA 2X7UA 1FR4A 3MNHA 3IBUA 1FR7A 1H9NA 2NNGA 1CNHA 1I9MA 1LZVA 1BN3A 1CAOA 3HKTA 1CVHA 3OKUA 2F14A 1CVCA 3MWOA 1CCUA 1Z93A 1CVFA 3D92A 1CVEA 1V9IC 1CRMA 4PYYA 3BL1A 1THKA 1URTA 1G4OA 2NNOA 1FLJA 1CNWA 2IT4A 1LGDA 2GD8A 3F8EA 1G53A 3M98A 2NNVA 5CACA 3MNUA 1RZEA 1JV0A 3BL0A 2NN1A 3KONA 2NWZA 2NN7A 3FE4A 2O4ZA 1G3ZA 3EFIA 2POUA 1XEVA 3DBUA 3R17B 3R16A 1IF9A 3CZVA 1DCBA 1FQMA 1BNVA 6CA2A 1CINA 1BNUA 1TG3A 1CAHA 2CA2A 1OKNA 3ML2A 1BICA 2WEHA 1EOUA 1CA3A 1G6VA 2NWPA 3DC3A 3OIKA 1BN1A 3B4FA 1IF6A 1FQRA 1CCTA 1BNMA 3HKNA 3IBNA 1BZMA 2X7TA 2NXTA 1CANA 1F2WA 3PYKA 3M96A 1I9OA 1LG5A 3M5SA 3HLJA 1RAZA 1G0EA 1IF7A 3L14A 3KS3A 3HKUA 2CBAA 2CBDA 9CA2A 1ZSCA 1UGEA 1IF5A 2WD2A 3F7BA 3HS4A 1CVBA 1HVAA 1G52A 3IBLA 1CRAA 3MHMA 2HL4A 2WEJA 3PO6A 3HFPA 1CA2A 3IAIA 3DVDA 3IBIA 2HKKA 1XQ0A 1ZE8A 1HCAA 1KOQA 7CA2A 1CAMA 1OQ5A 1TTMA 1FQNA 2CBCA 3NJ9A 1TEUX 3MNIA 3DD8A 2FW4A 3JXHC 1RAYA 2AW1A 3MHCA 3DA2A 3OIMA 1OKMA 1Z97A 1ZSAA 1UGBA 3ML5A 2HD6A 1H9QA 1CNGA 2WEOA 1G48A 1CAIA 1RZAA 1I90A 2NNSA 1BNQA 1FQLA 1I9PA 2CBEA 3M2YA 1A42A 1UGFA 3MMFA 1RZDA 1YDAA 1I9NA 1KWQA 2FNMA 2EU3A 3N0NA 2ILIA 1YO0A 1T9NA 3KWAA 1BN4A 1RZBA 3MHIA 2FMGA 3F7UA 3IEOA 1HEAA 1TBTX 1CZMA 3M67A 3F4XA 2CABA 3KOKA 3IGPA 1G4JA 8CA2A 2HNCA 3EFTA 1BNTA 3M1WA 1DCAA 1FSRA 3M40A 3CA2A 1HUHA 2OSMA 3DAZA 3P4VA 3GZ0A 2FMZA 2FOSA 3DCSA 3D0NA 1CNXA 1CAKA 1BNNA 2WD3A 1CNJA 1KEQA 2NMXA 1CNIA 1YDDA 1HEDA 1CCSA 2POVA 3N4BA 2GEHA 1IF8A 3M2ZA 3OILA 3ZNCA 3FFPX 3D8WA 1CILA 1TE3X 1YO1A 2Q1QA 1LG6A 3OKVA 3M5EA 3N3JA 1UGAA 3MNKA 1HCBA 3DD0A 1ZSBA 5CA2A 1LUGA 1AM6A 1CNCA 3HKQA 3M2NA 3NI5A 4CA2A 3K7KA 3DCCA 1RJ5A 2CBBA 3MYQA 1CAYA 2NWOA 1CALA 1G46A 1XPZA 1CNYA 2POWA 1YO2A 2VVBX 1IF4A 1JD0A 1I91A 2FOQA 2FOUA 1RJ6A
chains in the KnotProt database with same CATH topology
3MNJA 1G45A 3MDZA 1RZCA 2H15A 1KWRA 1H4NA 1I9QA 3DVCA 1ZNCA 2X7SA 3C7PA 3JXFA 1DMYA 1BV3A 2OSFA 3M5TA 2Q1BA 3M1QA 3B1BA 2HFWA 1V9EA 3D9ZA 1HECA 1BNWA 1CVAA 1UGDA 3MHLA 1MUAA 1Y7WA 2Q38A 1J9WA 2FNKA 1TH9A 3FW3A 3KIGA 4CACA 2NWYA 3DVBA 2HFXA 3LXEA 3D93A 2WEGA 2NXSA 1CVDA 1TG9A 2EZ7A 1AZMA 1BCDA 1HEBA 1FSNA 2NXRA 1YDCA 1I8ZA 1G0FA 1CIMA 2EU2A 1CAJA 3MHOA 3N2PA 3IQKA 3K34A 1I9LA 12CAA 2VVAX 3DC9A 2HFYA 3CAJA 1G1DA 2ABEA 3MNAA 1XEGA 2W2JA 1KOPA 3DCWA 3DV7A 1HUGA 1AVNA 2HOCA 3K2FA 3MZCA 1FSQA 3BETA 2AX2A 1CAZA 2ZNCA 1YDBA 3M1JA 3M3XA 3KKXA 3JXGA 2FNNA 2X7UA 1FR4A 3MNHA 3IBUA 1FR7A 1H9NA 2NNGA 1CNHA 1I9MA 1LZVA 1BN3A 1CAOA 3HKTA 1CVHA 3OKUA 2F14A 1CVCA 3MWOA 1CCUA 1Z93A 1CVFA 3D92A 1CVEA 1V9IC 1CRMA 3BL1A 1THKA 1URTA 1G4OA 2NNOA 1FLJA 1CNWA 2IT4A 1LGDA 2GD8A 3F8EA 1G53A 3M98A 2NNVA 5CACA 3MNUA 1RZEA 1JV0A 3BL0A 2NN1A 3KONA 2NWZA 2NN7A 3FE4A 2O4ZA 1G3ZA 3EFIA 2POUA 1XEVA 3DBUA 3R17B 3R16A 1IF9A 3CZVA 1DCBA 1FQMA 1BNVA 6CA2A 1CINA 1BNUA 1TG3A 1CAHA 2CA2A 1OKNA 3ML2A 1BICA 2WEHA 1EOUA 1CA3A 1G6VA 2NWPA 3DC3A 3OIKA 1BN1A 3B4FA 1IF6A 1FQRA 1CCTA 1BNMA 3HKNA 3IBNA 1BZMA 2X7TA 2NXTA 1CANA 1F2WA 3PYKA 3M96A 1I9OA 1LG5A 3M5SA 3HLJA 1RAZA 1G0EA 1IF7A 3L14A 3KS3A 3HKUA 2CBAA 2CBDA 9CA2A 1ZSCA 1UGEA 1IF5A 2WD2A 3F7BA 3HS4A 1CVBA 1HVAA 1G52A 3IBLA 1CRAA 3MHMA 2HL4A 2WEJA 3PO6A 3HFPA 1CA2A 3IAIA 3DVDA 3IBIA 2HKKA 1XQ0A 1ZE8A 1HCAA 1KOQA 7CA2A 1CAMA 1OQ5A 1TTMA 1FQNA 2CBCA 3NJ9A 1TEUX 3MNIA 3DD8A 2FW4A 3JXHC 1RAYA 2AW1A 3MHCA 3DA2A 3OIMA 1OKMA 1Z97A 1ZSAA 1UGBA 3ML5A 2HD6A 1H9QA 1CNGA 2WEOA 1G48A 1CAIA 1RZAA 1I90A 2NNSA 1BNQA 1FQLA 1I9PA 2CBEA 3M2YA 1A42A 1UGFA 3MMFA 1RZDA 1YDAA 1I9NA 1KWQA 2FNMA 2EU3A 3N0NA 2ILIA 1YO0A 1T9NA 3KWAA 1BN4A 1RZBA 3MHIA 2FMGA 3F7UA 3IEOA 1HEAA 1TBTX 1CZMA 3M67A 3F4XA 2CABA 3KOKA 3IGPA 1G4JA 8CA2A 2HNCA 3EFTA 1BNTA 3M1WA 1DCAA 1FSRA 3M40A 3CA2A 1HUHA 2OSMA 3DAZA 3P4VA 3GZ0A 2FMZA 2FOSA 3DCSA 3D0NA 1CNXA 1CAKA 1BNNA 2WD3A 1CNJA 1KEQA 2NMXA 1CNIA 1YDDA 1HEDA 1CCSA 2POVA 3N4BA 2GEHA 1IF8A 3M2ZA 3OILA 3ZNCA 3FFPX 3D8WA 1CILA 1TE3X 1YO1A 2Q1QA 1LG6A 3OKVA 3M5EA 3N3JA 1UGAA 3MNKA 1HCBA 3DD0A 1ZSBA 5CA2A 1LUGA 1AM6A 1CNCA 3HKQA 3M2NA 3NI5A 4CA2A 3K7KA 3DCCA 1RJ5A 2CBBA 3MYQA 1CAYA 2NWOA 1CALA 1G46A 1XPZA 1CNYA 2POWA 1YO2A 2VVBX 1IF4A 1JD0A 1I91A 2FOQA 2FOUA 1RJ6A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3MNJ A;  1G45 A;  3MDZ A;  1RZC A;  2H15 A;  1KWR A;  1H4N A;  1I9Q A;  3DVC A;  1ZNC A;  2X7S A;  3C7P A;  3JXF A;  1DMY A;  1BV3 A;  2OSF A;  3M5T A;  2Q1B A;  3M1Q A;  3B1B A;  2HFW A;  1V9E A;  3D9Z A;  1HEC A;  1BNW A;  1CVA A;  1UGD A;  3MHL A;  1MUA A;  1Y7W A;  2Q38 A;  1J9W A;  2FNK A;  1TH9 A;  3FW3 A;  3KIG A;  4CAC A;  2NWY A;  3DVB A;  2HFX A;  3LXE A;  3D93 A;  2WEG A;  2NXS A;  1CVD A;  1TG9 A;  2EZ7 A;  1AZM A;  1BCD A;  1HEB A;  1FSN A;  2NXR A;  1YDC A;  1I8Z A;  1G0F A;  1CIM A;  2EU2 A;  1CAJ A;  3MHO A;  3N2P A;  3IQK A;  3K34 A;  1I9L A;  12CA A;  2VVA X;  3DC9 A;  2HFY A;  3CAJ A;  1G1D A;  2ABE A;  3MNA A;  1XEG A;  2W2J A;  1KOP A;  3DCW A;  3DV7 A;  1HUG A;  1AVN A;  2HOC A;  3K2F A;  3MZC A;  1FSQ A;  3BET A;  2AX2 A;  1CAZ A;  2ZNC A;  1YDB A;  3M1J A;  3M3X A;  3KKX A;  3JXG A;  2FNN A;  2X7U A;  1FR4 A;  3MNH A;  3IBU A;  1FR7 A;  1H9N A;  2NNG A;  1CNH A;  1I9M A;  1LZV A;  1BN3 A;  1CAO A;  3HKT A;  1CVH A;  3OKU A;  2F14 A;  1CVC A;  3MWO A;  1CCU A;  1Z93 A;  1CVF A;  3D92 A;  1CVE A;  1V9I C;  1CRM A;  4PYY A;  3BL1 A;  1THK A;  1URT A;  1G4O A;  2NNO A;  1FLJ A;  1CNW A;  2IT4 A;  1LGD A;  2GD8 A;  3F8E A;  1G53 A;  3M98 A;  2NNV A;  5CAC A;  3MNU A;  1RZE A;  1JV0 A;  3BL0 A;  2NN1 A;  3KON A;  2NWZ A;  2NN7 A;  3FE4 A;  2O4Z A;  1G3Z A;  3EFI A;  2POU A;  1XEV A;  3DBU A;  3R17 B;  3R16 A;  1IF9 A;  3CZV A;  1DCB A;  1FQM A;  1BNV A;  6CA2 A;  1CIN A;  1BNU A;  1TG3 A;  1CAH A;  2CA2 A;  1OKN A;  3ML2 A;  1BIC A;  2WEH A;  1EOU A;  1CA3 A;  1G6V A;  2NWP A;  3DC3 A;  3OIK A;  1BN1 A;  3B4F A;  1IF6 A;  1FQR A;  1CCT A;  1BNM A;  3HKN A;  3IBN A;  1BZM A;  2X7T A;  2NXT A;  1CAN A;  1F2W A;  3PYK A;  3M96 A;  1I9O A;  1LG5 A;  3M5S A;  3HLJ A;  1RAZ A;  1G0E A;  1IF7 A;  3L14 A;  3KS3 A;  3HKU A;  2CBA A;  2CBD A;  9CA2 A;  1ZSC A;  1UGE A;  1IF5 A;  2WD2 A;  3F7B A;  3HS4 A;  1CVB A;  1HVA A;  1G52 A;  3IBL A;  1CRA A;  3MHM A;  2HL4 A;  2WEJ A;  3PO6 A;  3HFP A;  1CA2 A;  3IAI A;  3DVD A;  3IBI A;  2HKK A;  1XQ0 A;  1ZE8 A;  1HCA A;  1KOQ A;  7CA2 A;  1CAM A;  1OQ5 A;  1TTM A;  1FQN A;  2CBC A;  3NJ9 A;  1TEU X;  3MNI A;  3DD8 A;  2FW4 A;  3JXH C;  1RAY A;  2AW1 A;  3MHC A;  3DA2 A;  3OIM A;  1OKM A;  1Z97 A;  1ZSA A;  1UGB A;  3ML5 A;  2HD6 A;  1H9Q A;  1CNG A;  2WEO A;  1G48 A;  1CAI A;  1RZA A;  1I90 A;  2NNS A;  1BNQ A;  1FQL A;  1I9P A;  2CBE A;  3M2Y A;  1A42 A;  1UGF A;  3MMF A;  1RZD A;  1YDA A;  1I9N A;  1KWQ A;  2FNM A;  2EU3 A;  3N0N A;  2ILI A;  1YO0 A;  1T9N A;  3KWA A;  1BN4 A;  1RZB A;  3MHI A;  2FMG A;  3F7U A;  3IEO A;  1HEA A;  1TBT X;  1CZM A;  3M67 A;  3F4X A;  2CAB A;  3KOK A;  3IGP A;  1G4J A;  8CA2 A;  2HNC A;  3EFT A;  1BNT A;  3M1W A;  1DCA A;  1FSR A;  3M40 A;  3CA2 A;  1HUH A;  2OSM A;  3DAZ A;  3P4V A;  3GZ0 A;  2FMZ A;  2FOS A;  3DCS A;  3D0N A;  1CNX A;  1CAK A;  1BNN A;  2WD3 A;  1CNJ A;  1KEQ A;  2NMX A;  1CNI A;  1YDD A;  1HED A;  1CCS A;  2POV A;  3N4B A;  2GEH A;  1IF8 A;  3M2Z A;  3OIL A;  3ZNC A;  3FFP X;  3D8W A;  1CIL A;  1TE3 X;  1YO1 A;  2Q1Q A;  1LG6 A;  3OKV A;  3M5E A;  3N3J A;  1UGA A;  3MNK A;  1HCB A;  3DD0 A;  1ZSB A;  5CA2 A;  1LUG A;  1AM6 A;  1CNC A;  3HKQ A;  3M2N A;  3NI5 A;  4CA2 A;  3K7K A;  3DCC A;  1RJ5 A;  2CBB A;  3MYQ A;  1CAY A;  2NWO A;  1CAL A;  1G46 A;  1XPZ A;  1CNY A;  2POW A;  1YO2 A;  2VVB X;  1IF4 A;  1JD0 A;  1I91 A;  2FOQ A;  2FOU A;  1RJ6 A; 
#chains in the KnotProt database with same CATH topology
 3MNJ A;  1G45 A;  3MDZ A;  1RZC A;  2H15 A;  1KWR A;  1H4N A;  1I9Q A;  3DVC A;  1ZNC A;  2X7S A;  3C7P A;  3JXF A;  1DMY A;  1BV3 A;  2OSF A;  3M5T A;  2Q1B A;  3M1Q A;  3B1B A;  2HFW A;  1V9E A;  3D9Z A;  1HEC A;  1BNW A;  1CVA A;  1UGD A;  3MHL A;  1MUA A;  1Y7W A;  2Q38 A;  1J9W A;  2FNK A;  1TH9 A;  3FW3 A;  3KIG A;  4CAC A;  2NWY A;  3DVB A;  2HFX A;  3LXE A;  3D93 A;  2WEG A;  2NXS A;  1CVD A;  1TG9 A;  2EZ7 A;  1AZM A;  1BCD A;  1HEB A;  1FSN A;  2NXR A;  1YDC A;  1I8Z A;  1G0F A;  1CIM A;  2EU2 A;  1CAJ A;  3MHO A;  3N2P A;  3IQK A;  3K34 A;  1I9L A;  12CA A;  2VVA X;  3DC9 A;  2HFY A;  3CAJ A;  1G1D A;  2ABE A;  3MNA A;  1XEG A;  2W2J A;  1KOP A;  3DCW A;  3DV7 A;  1HUG A;  1AVN A;  2HOC A;  3K2F A;  3MZC A;  1FSQ A;  3BET A;  2AX2 A;  1CAZ A;  2ZNC A;  1YDB A;  3M1J A;  3M3X A;  3KKX A;  3JXG A;  2FNN A;  2X7U A;  1FR4 A;  3MNH A;  3IBU A;  1FR7 A;  1H9N A;  2NNG A;  1CNH A;  1I9M A;  1LZV A;  1BN3 A;  1CAO A;  3HKT A;  1CVH A;  3OKU A;  2F14 A;  1CVC A;  3MWO A;  1CCU A;  1Z93 A;  1CVF A;  3D92 A;  1CVE A;  1V9I C;  1CRM A;  4PYY A;  3BL1 A;  1THK A;  1URT A;  1G4O A;  2NNO A;  1FLJ A;  1CNW A;  2IT4 A;  1LGD A;  2GD8 A;  3F8E A;  1G53 A;  3M98 A;  2NNV A;  5CAC A;  3MNU A;  1RZE A;  1JV0 A;  3BL0 A;  2NN1 A;  3KON A;  2NWZ A;  2NN7 A;  3FE4 A;  2O4Z A;  1G3Z A;  3EFI A;  2POU A;  1XEV A;  3DBU A;  3R17 B;  3R16 A;  1IF9 A;  3CZV A;  1DCB A;  1FQM A;  1BNV A;  6CA2 A;  1CIN A;  1BNU A;  1TG3 A;  1CAH A;  2CA2 A;  1OKN A;  3ML2 A;  1BIC A;  2WEH A;  1EOU A;  1CA3 A;  1G6V A;  2NWP A;  3DC3 A;  3OIK A;  1BN1 A;  3B4F A;  1IF6 A;  1FQR A;  1CCT A;  1BNM A;  3HKN A;  3IBN A;  1BZM A;  2X7T A;  2NXT A;  1CAN A;  1F2W A;  3PYK A;  3M96 A;  1I9O A;  1LG5 A;  3M5S A;  3HLJ A;  1RAZ A;  1G0E A;  1IF7 A;  3L14 A;  3KS3 A;  3HKU A;  2CBA A;  2CBD A;  9CA2 A;  1ZSC A;  1UGE A;  1IF5 A;  2WD2 A;  3F7B A;  3HS4 A;  1CVB A;  1HVA A;  1G52 A;  3IBL A;  1CRA A;  3MHM A;  2HL4 A;  2WEJ A;  3PO6 A;  3HFP A;  1CA2 A;  3IAI A;  3DVD A;  3IBI A;  2HKK A;  1XQ0 A;  1ZE8 A;  1HCA A;  1KOQ A;  7CA2 A;  1CAM A;  1OQ5 A;  1TTM A;  1FQN A;  2CBC A;  3NJ9 A;  1TEU X;  3MNI A;  3DD8 A;  2FW4 A;  3JXH C;  1RAY A;  2AW1 A;  3MHC A;  3DA2 A;  3OIM A;  1OKM A;  1Z97 A;  1ZSA A;  1UGB A;  3ML5 A;  2HD6 A;  1H9Q A;  1CNG A;  2WEO A;  1G48 A;  1CAI A;  1RZA A;  1I90 A;  2NNS A;  1BNQ A;  1FQL A;  1I9P A;  2CBE A;  3M2Y A;  1A42 A;  1UGF A;  3MMF A;  1RZD A;  1YDA A;  1I9N A;  1KWQ A;  2FNM A;  2EU3 A;  3N0N A;  2ILI A;  1YO0 A;  1T9N A;  3KWA A;  1BN4 A;  1RZB A;  3MHI A;  2FMG A;  3F7U A;  3IEO A;  1HEA A;  1TBT X;  1CZM A;  3M67 A;  3F4X A;  2CAB A;  3KOK A;  3IGP A;  1G4J A;  8CA2 A;  2HNC A;  3EFT A;  1BNT A;  3M1W A;  1DCA A;  1FSR A;  3M40 A;  3CA2 A;  1HUH A;  2OSM A;  3DAZ A;  3P4V A;  3GZ0 A;  2FMZ A;  2FOS A;  3DCS A;  3D0N A;  1CNX A;  1CAK A;  1BNN A;  2WD3 A;  1CNJ A;  1KEQ A;  2NMX A;  1CNI A;  1YDD A;  1HED A;  1CCS A;  2POV A;  3N4B A;  2GEH A;  1IF8 A;  3M2Z A;  3OIL A;  3ZNC A;  3FFP X;  3D8W A;  1CIL A;  1TE3 X;  1YO1 A;  2Q1Q A;  1LG6 A;  3OKV A;  3M5E A;  3N3J A;  1UGA A;  3MNK A;  1HCB A;  3DD0 A;  1ZSB A;  5CA2 A;  1LUG A;  1AM6 A;  1CNC A;  3HKQ A;  3M2N A;  3NI5 A;  4CA2 A;  3K7K A;  3DCC A;  1RJ5 A;  2CBB A;  3MYQ A;  1CAY A;  2NWO A;  1CAL A;  1G46 A;  1XPZ A;  1CNY A;  2POW A;  1YO2 A;  2VVB X;  1IF4 A;  1JD0 A;  1I91 A;  2FOQ A;  2FOU A;  1RJ6 A; 
#chains in the KnotProt database with same CATH homology
 3MNJ A;  1G45 A;  3MDZ A;  1RZC A;  2H15 A;  1KWR A;  1H4N A;  1I9Q A;  3DVC A;  1ZNC A;  2X7S A;  3C7P A;  3JXF A;  1DMY A;  1BV3 A;  2OSF A;  3M5T A;  2Q1B A;  3M1Q A;  3B1B A;  2HFW A;  1V9E A;  3D9Z A;  1HEC A;  1BNW A;  1CVA A;  1UGD A;  3MHL A;  1MUA A;  1Y7W A;  2Q38 A;  1J9W A;  2FNK A;  1TH9 A;  3FW3 A;  3KIG A;  4CAC A;  2NWY A;  3DVB A;  2HFX A;  3LXE A;  3D93 A;  2WEG A;  2NXS A;  1CVD A;  1TG9 A;  2EZ7 A;  1AZM A;  1BCD A;  1HEB A;  1FSN A;  2NXR A;  1YDC A;  1I8Z A;  1G0F A;  1CIM A;  2EU2 A;  1CAJ A;  3MHO A;  3N2P A;  3IQK A;  3K34 A;  1I9L A;  12CA A;  2VVA X;  3DC9 A;  2HFY A;  3CAJ A;  1G1D A;  2ABE A;  3MNA A;  1XEG A;  2W2J A;  1KOP A;  3DCW A;  3DV7 A;  1HUG A;  1AVN A;  2HOC A;  3K2F A;  3MZC A;  1FSQ A;  3BET A;  2AX2 A;  1CAZ A;  2ZNC A;  1YDB A;  3M1J A;  3M3X A;  3KKX A;  3JXG A;  2FNN A;  2X7U A;  1FR4 A;  3MNH A;  3IBU A;  1FR7 A;  1H9N A;  2NNG A;  1CNH A;  1I9M A;  1LZV A;  1BN3 A;  1CAO A;  3HKT A;  1CVH A;  3OKU A;  2F14 A;  1CVC A;  3MWO A;  1CCU A;  1Z93 A;  1CVF A;  3D92 A;  1CVE A;  1V9I C;  1CRM A;  3BL1 A;  1THK A;  1URT A;  1G4O A;  2NNO A;  1FLJ A;  1CNW A;  2IT4 A;  1LGD A;  2GD8 A;  3F8E A;  1G53 A;  3M98 A;  2NNV A;  5CAC A;  3MNU A;  1RZE A;  1JV0 A;  3BL0 A;  2NN1 A;  3KON A;  2NWZ A;  2NN7 A;  3FE4 A;  2O4Z A;  1G3Z A;  3EFI A;  2POU A;  1XEV A;  3DBU A;  3R17 B;  3R16 A;  1IF9 A;  3CZV A;  1DCB A;  1FQM A;  1BNV A;  6CA2 A;  1CIN A;  1BNU A;  1TG3 A;  1CAH A;  2CA2 A;  1OKN A;  3ML2 A;  1BIC A;  2WEH A;  1EOU A;  1CA3 A;  1G6V A;  2NWP A;  3DC3 A;  3OIK A;  1BN1 A;  3B4F A;  1IF6 A;  1FQR A;  1CCT A;  1BNM A;  3HKN A;  3IBN A;  1BZM A;  2X7T A;  2NXT A;  1CAN A;  1F2W A;  3PYK A;  3M96 A;  1I9O A;  1LG5 A;  3M5S A;  3HLJ A;  1RAZ A;  1G0E A;  1IF7 A;  3L14 A;  3KS3 A;  3HKU A;  2CBA A;  2CBD A;  9CA2 A;  1ZSC A;  1UGE A;  1IF5 A;  2WD2 A;  3F7B A;  3HS4 A;  1CVB A;  1HVA A;  1G52 A;  3IBL A;  1CRA A;  3MHM A;  2HL4 A;  2WEJ A;  3PO6 A;  3HFP A;  1CA2 A;  3IAI A;  3DVD A;  3IBI A;  2HKK A;  1XQ0 A;  1ZE8 A;  1HCA A;  1KOQ A;  7CA2 A;  1CAM A;  1OQ5 A;  1TTM A;  1FQN A;  2CBC A;  3NJ9 A;  1TEU X;  3MNI A;  3DD8 A;  2FW4 A;  3JXH C;  1RAY A;  2AW1 A;  3MHC A;  3DA2 A;  3OIM A;  1OKM A;  1Z97 A;  1ZSA A;  1UGB A;  3ML5 A;  2HD6 A;  1H9Q A;  1CNG A;  2WEO A;  1G48 A;  1CAI A;  1RZA A;  1I90 A;  2NNS A;  1BNQ A;  1FQL A;  1I9P A;  2CBE A;  3M2Y A;  1A42 A;  1UGF A;  3MMF A;  1RZD A;  1YDA A;  1I9N A;  1KWQ A;  2FNM A;  2EU3 A;  3N0N A;  2ILI A;  1YO0 A;  1T9N A;  3KWA A;  1BN4 A;  1RZB A;  3MHI A;  2FMG A;  3F7U A;  3IEO A;  1HEA A;  1TBT X;  1CZM A;  3M67 A;  3F4X A;  2CAB A;  3KOK A;  3IGP A;  1G4J A;  8CA2 A;  2HNC A;  3EFT A;  1BNT A;  3M1W A;  1DCA A;  1FSR A;  3M40 A;  3CA2 A;  1HUH A;  2OSM A;  3DAZ A;  3P4V A;  3GZ0 A;  2FMZ A;  2FOS A;  3DCS A;  3D0N A;  1CNX A;  1CAK A;  1BNN A;  2WD3 A;  1CNJ A;  1KEQ A;  2NMX A;  1CNI A;  1YDD A;  1HED A;  1CCS A;  2POV A;  3N4B A;  2GEH A;  1IF8 A;  3M2Z A;  3OIL A;  3ZNC A;  3FFP X;  3D8W A;  1CIL A;  1TE3 X;  1YO1 A;  2Q1Q A;  1LG6 A;  3OKV A;  3M5E A;  3N3J A;  1UGA A;  3MNK A;  1HCB A;  3DD0 A;  1ZSB A;  5CA2 A;  1LUG A;  1AM6 A;  1CNC A;  3HKQ A;  3M2N A;  3NI5 A;  4CA2 A;  3K7K A;  3DCC A;  1RJ5 A;  2CBB A;  3MYQ A;  1CAY A;  2NWO A;  1CAL A;  1G46 A;  1XPZ A;  1CNY A;  2POW A;  1YO2 A;  2VVB X;  1IF4 A;  1JD0 A;  1I91 A;  2FOQ A;  2FOU A;  1RJ6 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling