2FNKA

Activation of human carbonic anhydrase ii by exogenous proton donors
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 25-256 232 1-24, 257-259 24 3 knot
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGWAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 3x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 23-255 233 1-22, 256-259 22 4 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureHis3 <-> Lys261
... His96 <->
Bridging ionZn262
<-> His94 ... His3
probabilistic
K +31 His3 ... His96 <->
Bridging ionZn262
<-> His119 ...
Chain closureLys261 <-> His3
probabilistic
K +31 His3 ... His94 <->
Bridging ionZn262
<-> His119 ...
Chain closureLys261 <-> His3
probabilistic
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGWAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 27-256 230 1-26, 257-258 26 2 knot
view details
2.1 25-252 228 1-24 258-258 253-257 24 1 slipknot
sequence length 258
structure length 258
publication title Location of binding sites in small molecule rescue of human carbonic anhydrase II.
pubmed doi rcsb
molecule tags Lyase
molecule keywords Carbonic anhydrase 2
source organism Homo sapiens
total genus Genus: 75
ec nomenclature ec 4.2.1.1: Carbonate dehydratase.
pdb deposition date 2006-01-11
KnotProt deposition date 2018-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Carbonic Anhydrase II 2fnkA00
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Carbonic Anhydrase II 2fnkA00
1CAKA 1FSRA 1OKMA 2EZ7A 1Z93A 1CVFA 1I9LA 2HFWA 2HOCA 1YO1A 1KOPA 1G52A 3FFPX 2CBBA 3KIGA 1KOQA 3IBLA 2VVBX 1G45A 1CNGA 1G46A 1CIMA 3IBUA 3F8EA 1YDAA 3MHIA 1XQ0A 3NJ9A 3DV7A 1OQ5A 3BETA 3MHCA 3ZNCA 3N4BA 1YO2A 1AZMA 3OIKA 2HL4A 3M96A 2NWPA 2NN7A 1AVNA 3PO6A 3CZVA 1TH9A 1CNHA 2POVA 1HECA 1RJ6A 2EU2A 2CA2A 1DCBA 1RAZA 1CCSA 1H9QA 1YDDA 2NXSA 2POUA 2WEJA 3MNHA 3HS4A 3M2YA 3DD8A 1URTA 1ZSAA 1CNXA 3K34A 1FQNA 3MWOA 2CBDA 3CAJA 3JXGA 2F14A 7CA2A 1CAHA 1CILA 1HEDA 3R17B 1LGDA 1XEGA 2FMGA 1CAOA 3HLJA 1KEQA 3DVBA 1CCTA 5CA2A 1FQLA 3F7BA 3ML2A 2HFYA 2NNOA 1BN3A 1KWQA 2WD2A 3MNUA 2AX2A 1BCDA 1KWRA 3DCSA 2AW1A 1CAZA 1BN1A 2NNVA 2WD3A 1H9NA 3CA2A 2WEHA 2NN1A 3IBIA 1FSNA 2Q1BA 2VVAX 1UGDA 1BICA 1CRAA 1I9NA 3DVDA 3MNIA 1I8ZA 3BL1A 1TEUX 1CINA 1CNIA 1RZDA 2NWYA 3DC3A 2X7TA 3KS3A 1RZEA 3MHOA 1I9MA 1EOUA 1RZCA 3N2PA 3P4VA 1HEBA 3L14A 1BNVA 1I9OA 1BNQA 1I9PA 1TTMA 3FW3A 1BNMA 1TG3A 1T9NA 2W2JA 1G48A 3M5TA 2NXRA 1FLJA 3NI5A 2H15A 1UGFA 2FOQA 2IT4A 1HCAA 3M2ZA 3F7UA 1LUGA 1BNTA 1YDCA 1CNYA 1XPZA 1FQRA 3JXHC 1UGBA 3MNAA 3KONA 1CVEA 1FR4A 1CNJA 3MZCA 1FQMA 2OSFA 1LG6A 3M2NA 1IF4A 1CVHA 1BNNA 1HUGA 1UGAA 3MNJA 1J9WA 3IGPA 1BN4A 1CAJA 1CNWA 2CBCA 3D9ZA 3M5EA 2CABA 2CBEA 3PYKA 3IQKA 1CZMA 1TE3X 3D93A 1V9EA 3OKVA 1Z97A 3M1QA 2EU3A 1HVAA 1TG9A 3D0NA 3JXFA 1F2WA 1CANA 3DD0A 1JV0A 3M40A 1G4JA 2X7SA 1FR7A 3DC9A 1LG5A 3DVCA 2NNGA 3MYQA 3B4FA 3HKUA 1CALA 2Q38A 2GD8A 1G0EA 1ZSCA 3IEOA 1YDBA 3OILA 2POWA 1MUAA 1IF7A 2HKKA 1HUHA 1I90A 3FE4A 1DMYA 3HKQA 2FNNA 1DCAA 1YO0A 2ABEA 3M98A 2NWZA 1ZSBA 1XEVA 1JD0A 1CVDA 3M5SA 1RAYA 1LZVA 2FOSA 3M3XA 2ZNCA 2NWOA 1CAYA 2FOUA 1CVBA 2WEOA 3K2FA 2FNKA 3MNKA 2HFXA 3F4XA 3N3JA 2FNMA 2HD6A 2FW4A 3EFTA 3KOKA 1G1DA 1G6VA 2Q1QA 1Y7WA 3M1JA 2X7UA 1G4OA 3MMFA 2O4ZA 1FSQA 3R16A 1UGEA 1BNWA 1CA2A 3MHLA 1IF6A 3MHMA 3HKTA 3KWAA 1G3ZA 1V9IC 3EFIA 3K7KA 3D8WA 1IF9A 2CBAA 1BNUA 1BZMA 1IF8A 1H4NA 3DCCA 3B1BA 1TBTX 1ZE8A 1THKA 3DAZA 2WEGA 2HNCA 1CVCA 3D92A 3DBUA 6CA2A 12CAA 1CA3A 9CA2A 8CA2A 3LXEA 4CA2A 1OKNA 2OSMA 3IAIA 3DCWA 3ML5A 1I9QA 3M1WA 1CAIA 3KKXA 1CRMA 2NXTA 2NMXA 1CCUA 2FMZA 5CACA 1HCBA 1BV3A 1G0FA 4PYYA 1A42A 4CACA 1CNCA 1ZNCA 1IF5A 1RZAA 3OKUA 3IBNA 1RZBA 1CVAA 3OIMA 3C7PA 1I91A 3HFPA 2ILIA 1AM6A 3N0NA 2GEHA 1CAMA 1HEAA 3GZ0A 3DA2A 3MDZA 3BL0A 2NNSA 1G53A 3HKNA 1RJ5A 3M67A
chains in the KnotProt database with same CATH superfamily
1CAKA 1FSRA 1OKMA 2EZ7A 1Z93A 1CVFA 1I9LA 2HFWA 2HOCA 1YO1A 1KOPA 1G52A 3FFPX 2CBBA 3KIGA 1KOQA 3IBLA 2VVBX 1G45A 1CNGA 1G46A 1CIMA 3IBUA 3F8EA 1YDAA 3MHIA 1XQ0A 3NJ9A 3DV7A 1OQ5A 3BETA 3MHCA 3ZNCA 3N4BA 1YO2A 1AZMA 3OIKA 2HL4A 3M96A 2NWPA 2NN7A 1AVNA 3PO6A 3CZVA 1TH9A 1CNHA 2POVA 1HECA 1RJ6A 2EU2A 2CA2A 1DCBA 1RAZA 1CCSA 1H9QA 1YDDA 2NXSA 2POUA 2WEJA 3MNHA 3HS4A 3M2YA 3DD8A 1URTA 1ZSAA 1CNXA 3K34A 1FQNA 3MWOA 2CBDA 3CAJA 3JXGA 2F14A 7CA2A 1CAHA 1CILA 1HEDA 3R17B 1LGDA 1XEGA 2FMGA 1CAOA 3HLJA 1KEQA 3DVBA 1CCTA 5CA2A 1FQLA 3F7BA 3ML2A 2HFYA 2NNOA 1BN3A 1KWQA 2WD2A 3MNUA 2AX2A 1BCDA 1KWRA 3DCSA 2AW1A 1CAZA 1BN1A 2NNVA 2WD3A 1H9NA 3CA2A 2WEHA 2NN1A 3IBIA 1FSNA 2Q1BA 2VVAX 1UGDA 1BICA 1CRAA 1I9NA 3DVDA 3MNIA 1I8ZA 3BL1A 1TEUX 1CINA 1CNIA 1RZDA 2NWYA 3DC3A 2X7TA 3KS3A 1RZEA 3MHOA 1I9MA 1EOUA 1RZCA 3N2PA 3P4VA 1HEBA 3L14A 1BNVA 1I9OA 1BNQA 1I9PA 1TTMA 3FW3A 1BNMA 1TG3A 1T9NA 2W2JA 1G48A 3M5TA 2NXRA 1FLJA 3NI5A 2H15A 1UGFA 2FOQA 2IT4A 1HCAA 3M2ZA 3F7UA 1LUGA 1BNTA 1YDCA 1CNYA 1XPZA 1FQRA 3JXHC 1UGBA 3MNAA 3KONA 1CVEA 1FR4A 1CNJA 3MZCA 1FQMA 2OSFA 1LG6A 3M2NA 1IF4A 1CVHA 1BNNA 1HUGA 1UGAA 3MNJA 1J9WA 3IGPA 1BN4A 1CAJA 1CNWA 2CBCA 3D9ZA 3M5EA 2CABA 2CBEA 3PYKA 3IQKA 1CZMA 1TE3X 3D93A 1V9EA 3OKVA 1Z97A 3M1QA 2EU3A 1HVAA 1TG9A 3D0NA 3JXFA 1F2WA 1CANA 3DD0A 1JV0A 3M40A 1G4JA 2X7SA 1FR7A 3DC9A 1LG5A 3DVCA 2NNGA 3MYQA 3B4FA 3HKUA 1CALA 2Q38A 2GD8A 1G0EA 1ZSCA 3IEOA 1YDBA 3OILA 2POWA 1MUAA 1IF7A 2HKKA 1HUHA 1I90A 3FE4A 1DMYA 3HKQA 2FNNA 1DCAA 1YO0A 2ABEA 3M98A 2NWZA 1ZSBA 1XEVA 1JD0A 1CVDA 3M5SA 1RAYA 1LZVA 2FOSA 3M3XA 2ZNCA 2NWOA 1CAYA 2FOUA 1CVBA 2WEOA 3K2FA 2FNKA 3MNKA 2HFXA 3F4XA 3N3JA 2FNMA 2HD6A 2FW4A 3EFTA 3KOKA 1G1DA 1G6VA 2Q1QA 1Y7WA 3M1JA 2X7UA 1G4OA 3MMFA 2O4ZA 1FSQA 3R16A 1UGEA 1BNWA 1CA2A 3MHLA 1IF6A 3MHMA 3HKTA 3KWAA 1G3ZA 1V9IC 3EFIA 3K7KA 3D8WA 1IF9A 2CBAA 1BNUA 1BZMA 1IF8A 1H4NA 3DCCA 3B1BA 1TBTX 1ZE8A 1THKA 3DAZA 2WEGA 2HNCA 1CVCA 3D92A 3DBUA 6CA2A 12CAA 1CA3A 9CA2A 8CA2A 3LXEA 4CA2A 1OKNA 2OSMA 3IAIA 3DCWA 3ML5A 1I9QA 3M1WA 1CAIA 3KKXA 1CRMA 2NXTA 2NMXA 1CCUA 2FMZA 5CACA 1HCBA 1BV3A 1G0FA 4PYYA 1A42A 4CACA 1CNCA 1ZNCA 1IF5A 1RZAA 3OKUA 3IBNA 1RZBA 1CVAA 3OIMA 3C7PA 1I91A 3HFPA 2ILIA 1AM6A 3N0NA 2GEHA 1CAMA 1HEAA 3GZ0A 3DA2A 3MDZA 3BL0A 2NNSA 1G53A 3HKNA 1RJ5A 3M67A
chains in the KnotProt database with same CATH topology
1CAKA 1FSRA 1OKMA 2EZ7A 1Z93A 1CVFA 1I9LA 2HFWA 2HOCA 1YO1A 1KOPA 1G52A 3FFPX 2CBBA 3KIGA 1KOQA 3IBLA 2VVBX 1G45A 1CNGA 1G46A 1CIMA 3IBUA 3F8EA 1YDAA 3MHIA 1XQ0A 3NJ9A 3DV7A 1OQ5A 3BETA 3MHCA 3ZNCA 3N4BA 1YO2A 1AZMA 3OIKA 2HL4A 3M96A 2NWPA 2NN7A 1AVNA 3PO6A 3CZVA 1TH9A 1CNHA 2POVA 1HECA 1RJ6A 2EU2A 2CA2A 1DCBA 1RAZA 1CCSA 1H9QA 1YDDA 2NXSA 2POUA 2WEJA 3MNHA 3HS4A 3M2YA 3DD8A 1URTA 1ZSAA 1CNXA 3K34A 1FQNA 3MWOA 2CBDA 3CAJA 3JXGA 2F14A 7CA2A 1CAHA 1CILA 1HEDA 3R17B 1LGDA 1XEGA 2FMGA 1CAOA 3HLJA 1KEQA 3DVBA 1CCTA 5CA2A 1FQLA 3F7BA 3ML2A 2HFYA 2NNOA 1BN3A 1KWQA 2WD2A 3MNUA 2AX2A 1BCDA 1KWRA 3DCSA 2AW1A 1CAZA 1BN1A 2NNVA 2WD3A 1H9NA 3CA2A 2WEHA 2NN1A 3IBIA 1FSNA 2Q1BA 2VVAX 1UGDA 1BICA 1CRAA 1I9NA 3DVDA 3MNIA 1I8ZA 3BL1A 1TEUX 1CINA 1CNIA 1RZDA 2NWYA 3DC3A 2X7TA 3KS3A 1RZEA 3MHOA 1I9MA 1EOUA 1RZCA 3N2PA 3P4VA 1HEBA 3L14A 1BNVA 1I9OA 1BNQA 1I9PA 1TTMA 3FW3A 1BNMA 1TG3A 1T9NA 2W2JA 1G48A 3M5TA 2NXRA 1FLJA 3NI5A 2H15A 1UGFA 2FOQA 2IT4A 1HCAA 3M2ZA 3F7UA 1LUGA 1BNTA 1YDCA 1CNYA 1XPZA 1FQRA 3JXHC 1UGBA 3MNAA 3KONA 1CVEA 1FR4A 1CNJA 3MZCA 1FQMA 2OSFA 1LG6A 3M2NA 1IF4A 1CVHA 1BNNA 1HUGA 1UGAA 3MNJA 1J9WA 3IGPA 1BN4A 1CAJA 1CNWA 2CBCA 3D9ZA 3M5EA 2CABA 2CBEA 3PYKA 3IQKA 1CZMA 1TE3X 3D93A 1V9EA 3OKVA 1Z97A 3M1QA 2EU3A 1HVAA 1TG9A 3D0NA 3JXFA 1F2WA 1CANA 3DD0A 1JV0A 3M40A 1G4JA 2X7SA 1FR7A 3DC9A 1LG5A 3DVCA 2NNGA 3MYQA 3B4FA 3HKUA 1CALA 2Q38A 2GD8A 1G0EA 1ZSCA 3IEOA 1YDBA 3OILA 2POWA 1MUAA 1IF7A 2HKKA 1HUHA 1I90A 3FE4A 1DMYA 3HKQA 2FNNA 1DCAA 1YO0A 2ABEA 3M98A 2NWZA 1ZSBA 1XEVA 1JD0A 1CVDA 3M5SA 1RAYA 1LZVA 2FOSA 3M3XA 2ZNCA 2NWOA 1CAYA 2FOUA 1CVBA 2WEOA 3K2FA 2FNKA 3MNKA 2HFXA 3F4XA 3N3JA 2FNMA 2HD6A 2FW4A 3EFTA 3KOKA 1G1DA 1G6VA 2Q1QA 1Y7WA 3M1JA 2X7UA 1G4OA 3MMFA 2O4ZA 1FSQA 3R16A 1UGEA 1BNWA 1CA2A 3MHLA 1IF6A 3MHMA 3HKTA 3KWAA 1G3ZA 1V9IC 3EFIA 3K7KA 3D8WA 1IF9A 2CBAA 1BNUA 1BZMA 1IF8A 1H4NA 3DCCA 3B1BA 1TBTX 1ZE8A 1THKA 3DAZA 2WEGA 2HNCA 1CVCA 3D92A 3DBUA 6CA2A 12CAA 1CA3A 9CA2A 8CA2A 3LXEA 4CA2A 1OKNA 2OSMA 3IAIA 3DCWA 3ML5A 1I9QA 3M1WA 1CAIA 3KKXA 1CRMA 2NXTA 2NMXA 1CCUA 2FMZA 5CACA 1HCBA 1BV3A 1G0FA 1A42A 4CACA 1CNCA 1ZNCA 1IF5A 1RZAA 3OKUA 3IBNA 1RZBA 1CVAA 3OIMA 3C7PA 1I91A 3HFPA 2ILIA 1AM6A 3N0NA 2GEHA 1CAMA 1HEAA 3GZ0A 3DA2A 3MDZA 3BL0A 2NNSA 1G53A 3HKNA 1RJ5A 3M67A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1CAK A;  1FSR A;  1OKM A;  2EZ7 A;  1Z93 A;  1CVF A;  1I9L A;  2HFW A;  2HOC A;  1YO1 A;  1KOP A;  1G52 A;  3FFP X;  2CBB A;  3KIG A;  1KOQ A;  3IBL A;  2VVB X;  1G45 A;  1CNG A;  1G46 A;  1CIM A;  3IBU A;  3F8E A;  1YDA A;  3MHI A;  1XQ0 A;  3NJ9 A;  3DV7 A;  1OQ5 A;  3BET A;  3MHC A;  3ZNC A;  3N4B A;  1YO2 A;  1AZM A;  3OIK A;  2HL4 A;  3M96 A;  2NWP A;  2NN7 A;  1AVN A;  3PO6 A;  3CZV A;  1TH9 A;  1CNH A;  2POV A;  1HEC A;  1RJ6 A;  2EU2 A;  2CA2 A;  1DCB A;  1RAZ A;  1CCS A;  1H9Q A;  1YDD A;  2NXS A;  2POU A;  2WEJ A;  3MNH A;  3HS4 A;  3M2Y A;  3DD8 A;  1URT A;  1ZSA A;  1CNX A;  3K34 A;  1FQN A;  3MWO A;  2CBD A;  3CAJ A;  3JXG A;  2F14 A;  7CA2 A;  1CAH A;  1CIL A;  1HED A;  3R17 B;  1LGD A;  1XEG A;  2FMG A;  1CAO A;  3HLJ A;  1KEQ A;  3DVB A;  1CCT A;  5CA2 A;  1FQL A;  3F7B A;  3ML2 A;  2HFY A;  2NNO A;  1BN3 A;  1KWQ A;  2WD2 A;  3MNU A;  2AX2 A;  1BCD A;  1KWR A;  3DCS A;  2AW1 A;  1CAZ A;  1BN1 A;  2NNV A;  2WD3 A;  1H9N A;  3CA2 A;  2WEH A;  2NN1 A;  3IBI A;  1FSN A;  2Q1B A;  2VVA X;  1UGD A;  1BIC A;  1CRA A;  1I9N A;  3DVD A;  3MNI A;  1I8Z A;  3BL1 A;  1TEU X;  1CIN A;  1CNI A;  1RZD A;  2NWY A;  3DC3 A;  2X7T A;  3KS3 A;  1RZE A;  3MHO A;  1I9M A;  1EOU A;  1RZC A;  3N2P A;  3P4V A;  1HEB A;  3L14 A;  1BNV A;  1I9O A;  1BNQ A;  1I9P A;  1TTM A;  3FW3 A;  1BNM A;  1TG3 A;  1T9N A;  2W2J A;  1G48 A;  3M5T A;  2NXR A;  1FLJ A;  3NI5 A;  2H15 A;  1UGF A;  2FOQ A;  2IT4 A;  1HCA A;  3M2Z A;  3F7U A;  1LUG A;  1BNT A;  1YDC A;  1CNY A;  1XPZ A;  1FQR A;  3JXH C;  1UGB A;  3MNA A;  3KON A;  1CVE A;  1FR4 A;  1CNJ A;  3MZC A;  1FQM A;  2OSF A;  1LG6 A;  3M2N A;  1IF4 A;  1CVH A;  1BNN A;  1HUG A;  1UGA A;  3MNJ A;  1J9W A;  3IGP A;  1BN4 A;  1CAJ A;  1CNW A;  2CBC A;  3D9Z A;  3M5E A;  2CAB A;  2CBE A;  3PYK A;  3IQK A;  1CZM A;  1TE3 X;  3D93 A;  1V9E A;  3OKV A;  1Z97 A;  3M1Q A;  2EU3 A;  1HVA A;  1TG9 A;  3D0N A;  3JXF A;  1F2W A;  1CAN A;  3DD0 A;  1JV0 A;  3M40 A;  1G4J A;  2X7S A;  1FR7 A;  3DC9 A;  1LG5 A;  3DVC A;  2NNG A;  3MYQ A;  3B4F A;  3HKU A;  1CAL A;  2Q38 A;  2GD8 A;  1G0E A;  1ZSC A;  3IEO A;  1YDB A;  3OIL A;  2POW A;  1MUA A;  1IF7 A;  2HKK A;  1HUH A;  1I90 A;  3FE4 A;  1DMY A;  3HKQ A;  2FNN A;  1DCA A;  1YO0 A;  2ABE A;  3M98 A;  2NWZ A;  1ZSB A;  1XEV A;  1JD0 A;  1CVD A;  3M5S A;  1RAY A;  1LZV A;  2FOS A;  3M3X A;  2ZNC A;  2NWO A;  1CAY A;  2FOU A;  1CVB A;  2WEO A;  3K2F A;  2FNK A;  3MNK A;  2HFX A;  3F4X A;  3N3J A;  2FNM A;  2HD6 A;  2FW4 A;  3EFT A;  3KOK A;  1G1D A;  1G6V A;  2Q1Q A;  1Y7W A;  3M1J A;  2X7U A;  1G4O A;  3MMF A;  2O4Z A;  1FSQ A;  3R16 A;  1UGE A;  1BNW A;  1CA2 A;  3MHL A;  1IF6 A;  3MHM A;  3HKT A;  3KWA A;  1G3Z A;  1V9I C;  3EFI A;  3K7K A;  3D8W A;  1IF9 A;  2CBA A;  1BNU A;  1BZM A;  1IF8 A;  1H4N A;  3DCC A;  3B1B A;  1TBT X;  1ZE8 A;  1THK A;  3DAZ A;  2WEG A;  2HNC A;  1CVC A;  3D92 A;  3DBU A;  6CA2 A;  12CA A;  1CA3 A;  9CA2 A;  8CA2 A;  3LXE A;  4CA2 A;  1OKN A;  2OSM A;  3IAI A;  3DCW A;  3ML5 A;  1I9Q A;  3M1W A;  1CAI A;  3KKX A;  1CRM A;  2NXT A;  2NMX A;  1CCU A;  2FMZ A;  5CAC A;  1HCB A;  1BV3 A;  1G0F A;  4PYY A;  1A42 A;  4CAC A;  1CNC A;  1ZNC A;  1IF5 A;  1RZA A;  3OKU A;  3IBN A;  1RZB A;  1CVA A;  3OIM A;  3C7P A;  1I91 A;  3HFP A;  2ILI A;  1AM6 A;  3N0N A;  2GEH A;  1CAM A;  1HEA A;  3GZ0 A;  3DA2 A;  3MDZ A;  3BL0 A;  2NNS A;  1G53 A;  3HKN A;  1RJ5 A;  3M67 A; 
#chains in the KnotProt database with same CATH topology
 1CAK A;  1FSR A;  1OKM A;  2EZ7 A;  1Z93 A;  1CVF A;  1I9L A;  2HFW A;  2HOC A;  1YO1 A;  1KOP A;  1G52 A;  3FFP X;  2CBB A;  3KIG A;  1KOQ A;  3IBL A;  2VVB X;  1G45 A;  1CNG A;  1G46 A;  1CIM A;  3IBU A;  3F8E A;  1YDA A;  3MHI A;  1XQ0 A;  3NJ9 A;  3DV7 A;  1OQ5 A;  3BET A;  3MHC A;  3ZNC A;  3N4B A;  1YO2 A;  1AZM A;  3OIK A;  2HL4 A;  3M96 A;  2NWP A;  2NN7 A;  1AVN A;  3PO6 A;  3CZV A;  1TH9 A;  1CNH A;  2POV A;  1HEC A;  1RJ6 A;  2EU2 A;  2CA2 A;  1DCB A;  1RAZ A;  1CCS A;  1H9Q A;  1YDD A;  2NXS A;  2POU A;  2WEJ A;  3MNH A;  3HS4 A;  3M2Y A;  3DD8 A;  1URT A;  1ZSA A;  1CNX A;  3K34 A;  1FQN A;  3MWO A;  2CBD A;  3CAJ A;  3JXG A;  2F14 A;  7CA2 A;  1CAH A;  1CIL A;  1HED A;  3R17 B;  1LGD A;  1XEG A;  2FMG A;  1CAO A;  3HLJ A;  1KEQ A;  3DVB A;  1CCT A;  5CA2 A;  1FQL A;  3F7B A;  3ML2 A;  2HFY A;  2NNO A;  1BN3 A;  1KWQ A;  2WD2 A;  3MNU A;  2AX2 A;  1BCD A;  1KWR A;  3DCS A;  2AW1 A;  1CAZ A;  1BN1 A;  2NNV A;  2WD3 A;  1H9N A;  3CA2 A;  2WEH A;  2NN1 A;  3IBI A;  1FSN A;  2Q1B A;  2VVA X;  1UGD A;  1BIC A;  1CRA A;  1I9N A;  3DVD A;  3MNI A;  1I8Z A;  3BL1 A;  1TEU X;  1CIN A;  1CNI A;  1RZD A;  2NWY A;  3DC3 A;  2X7T A;  3KS3 A;  1RZE A;  3MHO A;  1I9M A;  1EOU A;  1RZC A;  3N2P A;  3P4V A;  1HEB A;  3L14 A;  1BNV A;  1I9O A;  1BNQ A;  1I9P A;  1TTM A;  3FW3 A;  1BNM A;  1TG3 A;  1T9N A;  2W2J A;  1G48 A;  3M5T A;  2NXR A;  1FLJ A;  3NI5 A;  2H15 A;  1UGF A;  2FOQ A;  2IT4 A;  1HCA A;  3M2Z A;  3F7U A;  1LUG A;  1BNT A;  1YDC A;  1CNY A;  1XPZ A;  1FQR A;  3JXH C;  1UGB A;  3MNA A;  3KON A;  1CVE A;  1FR4 A;  1CNJ A;  3MZC A;  1FQM A;  2OSF A;  1LG6 A;  3M2N A;  1IF4 A;  1CVH A;  1BNN A;  1HUG A;  1UGA A;  3MNJ A;  1J9W A;  3IGP A;  1BN4 A;  1CAJ A;  1CNW A;  2CBC A;  3D9Z A;  3M5E A;  2CAB A;  2CBE A;  3PYK A;  3IQK A;  1CZM A;  1TE3 X;  3D93 A;  1V9E A;  3OKV A;  1Z97 A;  3M1Q A;  2EU3 A;  1HVA A;  1TG9 A;  3D0N A;  3JXF A;  1F2W A;  1CAN A;  3DD0 A;  1JV0 A;  3M40 A;  1G4J A;  2X7S A;  1FR7 A;  3DC9 A;  1LG5 A;  3DVC A;  2NNG A;  3MYQ A;  3B4F A;  3HKU A;  1CAL A;  2Q38 A;  2GD8 A;  1G0E A;  1ZSC A;  3IEO A;  1YDB A;  3OIL A;  2POW A;  1MUA A;  1IF7 A;  2HKK A;  1HUH A;  1I90 A;  3FE4 A;  1DMY A;  3HKQ A;  2FNN A;  1DCA A;  1YO0 A;  2ABE A;  3M98 A;  2NWZ A;  1ZSB A;  1XEV A;  1JD0 A;  1CVD A;  3M5S A;  1RAY A;  1LZV A;  2FOS A;  3M3X A;  2ZNC A;  2NWO A;  1CAY A;  2FOU A;  1CVB A;  2WEO A;  3K2F A;  2FNK A;  3MNK A;  2HFX A;  3F4X A;  3N3J A;  2FNM A;  2HD6 A;  2FW4 A;  3EFT A;  3KOK A;  1G1D A;  1G6V A;  2Q1Q A;  1Y7W A;  3M1J A;  2X7U A;  1G4O A;  3MMF A;  2O4Z A;  1FSQ A;  3R16 A;  1UGE A;  1BNW A;  1CA2 A;  3MHL A;  1IF6 A;  3MHM A;  3HKT A;  3KWA A;  1G3Z A;  1V9I C;  3EFI A;  3K7K A;  3D8W A;  1IF9 A;  2CBA A;  1BNU A;  1BZM A;  1IF8 A;  1H4N A;  3DCC A;  3B1B A;  1TBT X;  1ZE8 A;  1THK A;  3DAZ A;  2WEG A;  2HNC A;  1CVC A;  3D92 A;  3DBU A;  6CA2 A;  12CA A;  1CA3 A;  9CA2 A;  8CA2 A;  3LXE A;  4CA2 A;  1OKN A;  2OSM A;  3IAI A;  3DCW A;  3ML5 A;  1I9Q A;  3M1W A;  1CAI A;  3KKX A;  1CRM A;  2NXT A;  2NMX A;  1CCU A;  2FMZ A;  5CAC A;  1HCB A;  1BV3 A;  1G0F A;  4PYY A;  1A42 A;  4CAC A;  1CNC A;  1ZNC A;  1IF5 A;  1RZA A;  3OKU A;  3IBN A;  1RZB A;  1CVA A;  3OIM A;  3C7P A;  1I91 A;  3HFP A;  2ILI A;  1AM6 A;  3N0N A;  2GEH A;  1CAM A;  1HEA A;  3GZ0 A;  3DA2 A;  3MDZ A;  3BL0 A;  2NNS A;  1G53 A;  3HKN A;  1RJ5 A;  3M67 A; 
#chains in the KnotProt database with same CATH homology
 1CAK A;  1FSR A;  1OKM A;  2EZ7 A;  1Z93 A;  1CVF A;  1I9L A;  2HFW A;  2HOC A;  1YO1 A;  1KOP A;  1G52 A;  3FFP X;  2CBB A;  3KIG A;  1KOQ A;  3IBL A;  2VVB X;  1G45 A;  1CNG A;  1G46 A;  1CIM A;  3IBU A;  3F8E A;  1YDA A;  3MHI A;  1XQ0 A;  3NJ9 A;  3DV7 A;  1OQ5 A;  3BET A;  3MHC A;  3ZNC A;  3N4B A;  1YO2 A;  1AZM A;  3OIK A;  2HL4 A;  3M96 A;  2NWP A;  2NN7 A;  1AVN A;  3PO6 A;  3CZV A;  1TH9 A;  1CNH A;  2POV A;  1HEC A;  1RJ6 A;  2EU2 A;  2CA2 A;  1DCB A;  1RAZ A;  1CCS A;  1H9Q A;  1YDD A;  2NXS A;  2POU A;  2WEJ A;  3MNH A;  3HS4 A;  3M2Y A;  3DD8 A;  1URT A;  1ZSA A;  1CNX A;  3K34 A;  1FQN A;  3MWO A;  2CBD A;  3CAJ A;  3JXG A;  2F14 A;  7CA2 A;  1CAH A;  1CIL A;  1HED A;  3R17 B;  1LGD A;  1XEG A;  2FMG A;  1CAO A;  3HLJ A;  1KEQ A;  3DVB A;  1CCT A;  5CA2 A;  1FQL A;  3F7B A;  3ML2 A;  2HFY A;  2NNO A;  1BN3 A;  1KWQ A;  2WD2 A;  3MNU A;  2AX2 A;  1BCD A;  1KWR A;  3DCS A;  2AW1 A;  1CAZ A;  1BN1 A;  2NNV A;  2WD3 A;  1H9N A;  3CA2 A;  2WEH A;  2NN1 A;  3IBI A;  1FSN A;  2Q1B A;  2VVA X;  1UGD A;  1BIC A;  1CRA A;  1I9N A;  3DVD A;  3MNI A;  1I8Z A;  3BL1 A;  1TEU X;  1CIN A;  1CNI A;  1RZD A;  2NWY A;  3DC3 A;  2X7T A;  3KS3 A;  1RZE A;  3MHO A;  1I9M A;  1EOU A;  1RZC A;  3N2P A;  3P4V A;  1HEB A;  3L14 A;  1BNV A;  1I9O A;  1BNQ A;  1I9P A;  1TTM A;  3FW3 A;  1BNM A;  1TG3 A;  1T9N A;  2W2J A;  1G48 A;  3M5T A;  2NXR A;  1FLJ A;  3NI5 A;  2H15 A;  1UGF A;  2FOQ A;  2IT4 A;  1HCA A;  3M2Z A;  3F7U A;  1LUG A;  1BNT A;  1YDC A;  1CNY A;  1XPZ A;  1FQR A;  3JXH C;  1UGB A;  3MNA A;  3KON A;  1CVE A;  1FR4 A;  1CNJ A;  3MZC A;  1FQM A;  2OSF A;  1LG6 A;  3M2N A;  1IF4 A;  1CVH A;  1BNN A;  1HUG A;  1UGA A;  3MNJ A;  1J9W A;  3IGP A;  1BN4 A;  1CAJ A;  1CNW A;  2CBC A;  3D9Z A;  3M5E A;  2CAB A;  2CBE A;  3PYK A;  3IQK A;  1CZM A;  1TE3 X;  3D93 A;  1V9E A;  3OKV A;  1Z97 A;  3M1Q A;  2EU3 A;  1HVA A;  1TG9 A;  3D0N A;  3JXF A;  1F2W A;  1CAN A;  3DD0 A;  1JV0 A;  3M40 A;  1G4J A;  2X7S A;  1FR7 A;  3DC9 A;  1LG5 A;  3DVC A;  2NNG A;  3MYQ A;  3B4F A;  3HKU A;  1CAL A;  2Q38 A;  2GD8 A;  1G0E A;  1ZSC A;  3IEO A;  1YDB A;  3OIL A;  2POW A;  1MUA A;  1IF7 A;  2HKK A;  1HUH A;  1I90 A;  3FE4 A;  1DMY A;  3HKQ A;  2FNN A;  1DCA A;  1YO0 A;  2ABE A;  3M98 A;  2NWZ A;  1ZSB A;  1XEV A;  1JD0 A;  1CVD A;  3M5S A;  1RAY A;  1LZV A;  2FOS A;  3M3X A;  2ZNC A;  2NWO A;  1CAY A;  2FOU A;  1CVB A;  2WEO A;  3K2F A;  2FNK A;  3MNK A;  2HFX A;  3F4X A;  3N3J A;  2FNM A;  2HD6 A;  2FW4 A;  3EFT A;  3KOK A;  1G1D A;  1G6V A;  2Q1Q A;  1Y7W A;  3M1J A;  2X7U A;  1G4O A;  3MMF A;  2O4Z A;  1FSQ A;  3R16 A;  1UGE A;  1BNW A;  1CA2 A;  3MHL A;  1IF6 A;  3MHM A;  3HKT A;  3KWA A;  1G3Z A;  1V9I C;  3EFI A;  3K7K A;  3D8W A;  1IF9 A;  2CBA A;  1BNU A;  1BZM A;  1IF8 A;  1H4N A;  3DCC A;  3B1B A;  1TBT X;  1ZE8 A;  1THK A;  3DAZ A;  2WEG A;  2HNC A;  1CVC A;  3D92 A;  3DBU A;  6CA2 A;  12CA A;  1CA3 A;  9CA2 A;  8CA2 A;  3LXE A;  4CA2 A;  1OKN A;  2OSM A;  3IAI A;  3DCW A;  3ML5 A;  1I9Q A;  3M1W A;  1CAI A;  3KKX A;  1CRM A;  2NXT A;  2NMX A;  1CCU A;  2FMZ A;  5CAC A;  1HCB A;  1BV3 A;  1G0F A;  1A42 A;  4CAC A;  1CNC A;  1ZNC A;  1IF5 A;  1RZA A;  3OKU A;  3IBN A;  1RZB A;  1CVA A;  3OIM A;  3C7P A;  1I91 A;  3HFP A;  2ILI A;  1AM6 A;  3N0N A;  2GEH A;  1CAM A;  1HEA A;  3GZ0 A;  3DA2 A;  3MDZ A;  3BL0 A;  2NNS A;  1G53 A;  3HKN A;  1RJ5 A;  3M67 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling