1NS5A

X-ray structure of ybea from e.coli. northeast structural genomics research consortium (nesg) target er45
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 71-119 49 1-70, 120-153 70 34 knot
Chain Sequence
MKLQLVAVGTKMPDWVQTGFTEYLRRFPKDMPFELIEIPAGKRGKNADIKRILDKEGEQMLAAAGKNRIVTLDIPGKPWDTPQLAAELERWKLDGRDVSLLIGGPEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYH
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 70-120 51 1-69, 121-153 69 33 knot
view details
2.1 68-117 50 1-67 123-153 118-122 67 31 slipknot
sequence length 153
structure length 153
publication title Structure of YBEA from E. coli
rcsb
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein ybeA
source organism Escherichia coli
total genus Genus: 50
ec nomenclature ec 2.1.1.177: 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase.
pdb deposition date 2003-01-27
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02590 SPOUT_MTase Predicted SPOUT methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1ns5A00
1ZJRA 4CNGB 3E5YA 1J85A 3ILKA 2Z0YA 1NXZA 4IG6A 3NK7A 1NS5A 3L8UA 3IC6A 1V6ZA 1GZ0A 1UAMA 1K3RA 2I6DA 3N4KA 4E8BA 4CNFB 2QWVA 3ONPA 3KY7A 1MXIA 1UALA 1V2XA 1X7PA 1P9PA 3GYQA 1UAJA 3AI9X 3NK6A 2HA8A 4H3ZA 2QMMA 3AIAA 4CNEB 3DCMX 3AXZA 1UAKA 3KTYA 1VHKA 1VHYA 1O6DA 2YY8A 3IEFA 4FAKA 2CX8A 1VH0A 3N4JA 2O3AA 3KNUA 4H3YA 1TO0A 3QUVA 1X7OA
chains in the KnotProt database with same CATH superfamily
1ZJRA 4CNGB 3E5YA 1J85A 3ILKA 2Z0YA 1NXZA 4IG6A 3NK7A 1NS5A 3L8UA 3IC6A 1V6ZA 1GZ0A 1UAMA 1K3RA 2I6DA 3N4KA 4E8BA 4CNFB 2QWVA 3ONPA 3KY7A 1MXIA 1UALA 1V2XA 1X7PA 1P9PA 3GYQA 1UAJA 3AI9X 3NK6A 2HA8A 4H3ZA 2QMMA 3AIAA 4CNEB 3DCMX 3AXZA 1UAKA 3KTYA 1VHKA 1VHYA 1O6DA 2YY8A 3IEFA 4FAKA 2CX8A 1VH0A 3N4JA 2O3AA 3KNUA 4H3YA 1TO0A 3QUVA 1X7OA
chains in the KnotProt database with same CATH topology
1ZJRA 4CNGB 3E5YA 1J85A 3ILKA 2Z0YA 1NXZA 4IG6A 3NK7A 1NS5A 3L8UA 3IC6A 1V6ZA 1GZ0A 1UAMA 1K3RA 2I6DA 3N4KA 4E8BA 4CNFB 2QWVA 3ONPA 3KY7A 1MXIA 1UALA 1V2XA 1X7PA 1P9PA 3GYQA 1UAJA 3AI9X 3NK6A 2HA8A 4H3ZA 2QMMA 3AIAA 4CNEB 3DCMX 3AXZA 1UAKA 3KTYA 1VHKA 1VHYA 1O6DA 2YY8A 3IEFA 4FAKA 2CX8A 1VH0A 3N4JA 2O3AA 3KNUA 4H3YA 1TO0A 3QUVA 1X7OA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1ZJR A;  4CNG B;  3E5Y A;  1J85 A;  3ILK A;  2Z0Y A;  1NXZ A;  4IG6 A;  3NK7 A;  1NS5 A;  3L8U A;  3IC6 A;  1V6Z A;  1GZ0 A;  1UAM A;  1K3R A;  2I6D A;  3N4K A;  4E8B A;  4CNF B;  2QWV A;  3ONP A;  3KY7 A;  1MXI A;  1UAL A;  1V2X A;  1X7P A;  1P9P A;  3GYQ A;  1UAJ A;  3AI9 X;  3NK6 A;  2HA8 A;  4H3Z A;  2QMM A;  3AIA A;  4CNE B;  3DCM X;  3AXZ A;  1UAK A;  3KTY A;  1VHK A;  1VHY A;  1O6D A;  2YY8 A;  3IEF A;  4FAK A;  2CX8 A;  1VH0 A;  3N4J A;  2O3A A;  3KNU A;  4H3Y A;  1TO0 A;  3QUV A;  1X7O A; 
#chains in the KnotProt database with same CATH topology
 1ZJR A;  4CNG B;  3E5Y A;  1J85 A;  3ILK A;  2Z0Y A;  1NXZ A;  4IG6 A;  3NK7 A;  1NS5 A;  3L8U A;  3IC6 A;  1V6Z A;  1GZ0 A;  1UAM A;  1K3R A;  2I6D A;  3N4K A;  4E8B A;  4CNF B;  2QWV A;  3ONP A;  3KY7 A;  1MXI A;  1UAL A;  1V2X A;  1X7P A;  1P9P A;  3GYQ A;  1UAJ A;  3AI9 X;  3NK6 A;  2HA8 A;  4H3Z A;  2QMM A;  3AIA A;  4CNE B;  3DCM X;  3AXZ A;  1UAK A;  3KTY A;  1VHK A;  1VHY A;  1O6D A;  2YY8 A;  3IEF A;  4FAK A;  2CX8 A;  1VH0 A;  3N4J A;  2O3A A;  3KNU A;  4H3Y A;  1TO0 A;  3QUV A;  1X7O A; 
#chains in the KnotProt database with same CATH homology
 1ZJR A;  4CNG B;  3E5Y A;  1J85 A;  3ILK A;  2Z0Y A;  1NXZ A;  4IG6 A;  3NK7 A;  1NS5 A;  3L8U A;  3IC6 A;  1V6Z A;  1GZ0 A;  1UAM A;  1K3R A;  2I6D A;  3N4K A;  4E8B A;  4CNF B;  2QWV A;  3ONP A;  3KY7 A;  1MXI A;  1UAL A;  1V2X A;  1X7P A;  1P9P A;  3GYQ A;  1UAJ A;  3AI9 X;  3NK6 A;  2HA8 A;  4H3Z A;  2QMM A;  3AIA A;  4CNE B;  3DCM X;  3AXZ A;  1UAK A;  3KTY A;  1VHK A;  1VHY A;  1O6D A;  2YY8 A;  3IEF A;  4FAK A;  2CX8 A;  1VH0 A;  3N4J A;  2O3A A;  3KNU A;  4H3Y A;  1TO0 A;  3QUV A;  1X7O A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling