1VH0A

Crystal structure of a hypothetical protein
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 75-124 50 1-74, 125-157 74 33 knot
Chain Sequence
LKITILAVGKLKEKYWKQAIAEYEKRLGPYTKIDIIEVPDEKAPENMSDKEIEQVKEKEGQRILAKIKPQSTVITLEIQGKMLSSEGLAQELNQRMTQGQSDFVFVIGGSNGLHKDVLQRSNYALSFSKMTFPHQMMRVVLIEQVYRAFKIMRGEAY
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 74-125 52 1-73, 126-157 73 32 knot
view details
2.1 72-122 51 1-71 129-157 123-128 71 29 slipknot
view details
3.1 75-127 53 128-157 1-73 74-74 73 29 slipknot
sequence length 157
structure length 157
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical UPF0247 protein SAV0024/SA0023
source organism Staphylococcus aureus
total genus Genus: 54
ec nomenclature ec 2.1.1.177: 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase.
pdb deposition date 2003-11-03
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02590 SPOUT_MTase Predicted SPOUT methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1vh0A00
1O6DA 1VHKA 2YY8A 3AXZA 1VH0A 4E8BA 2QWVA 1V2XA 1GZ0A 2HA8A 2CX8A 1VHYA 1X7OA 1UAKA 1NS5A 1UALA 3QUVA 4CNFB 1V6ZA 1X7PA 3GYQA 1K3RA 1UAMA 3ILKA 3KY7A 4H3ZA 3AI9X 1P9PA 3DCMX 3N4JA 2QMMA 3NK6A 1UAJA 1NXZA 1TO0A 3NK7A 3ONPA 3N4KA 2O3AA 4FAKA 4H3YA 1ZJRA 2Z0YA 1MXIA 3IEFA 1J85A 4CNGB 3E5YA 3KNUA 4CNEB 3KTYA 2I6DA 3AIAA 3L8UA 4IG6A 3IC6A
chains in the KnotProt database with same CATH superfamily
1O6DA 1VHKA 2YY8A 3AXZA 1VH0A 4E8BA 2QWVA 1V2XA 1GZ0A 2HA8A 2CX8A 1VHYA 1X7OA 1UAKA 1NS5A 1UALA 3QUVA 4CNFB 1V6ZA 1X7PA 3GYQA 1K3RA 1UAMA 3ILKA 3KY7A 4H3ZA 3AI9X 1P9PA 3DCMX 3N4JA 2QMMA 3NK6A 1UAJA 1NXZA 1TO0A 3NK7A 3ONPA 3N4KA 2O3AA 4FAKA 4H3YA 1ZJRA 2Z0YA 1MXIA 3IEFA 1J85A 4CNGB 3E5YA 3KNUA 4CNEB 3KTYA 2I6DA 3AIAA 3L8UA 4IG6A 3IC6A
chains in the KnotProt database with same CATH topology
1O6DA 1VHKA 2YY8A 3AXZA 1VH0A 4E8BA 2QWVA 1V2XA 1GZ0A 2HA8A 2CX8A 1VHYA 1X7OA 1UAKA 1NS5A 1UALA 3QUVA 4CNFB 1V6ZA 1X7PA 3GYQA 1K3RA 1UAMA 3ILKA 3KY7A 4H3ZA 3AI9X 1P9PA 3DCMX 3N4JA 2QMMA 3NK6A 1UAJA 1NXZA 1TO0A 3NK7A 3ONPA 3N4KA 2O3AA 4FAKA 4H3YA 1ZJRA 2Z0YA 1MXIA 3IEFA 1J85A 4CNGB 3E5YA 3KNUA 4CNEB 3KTYA 2I6DA 3AIAA 3L8UA 4IG6A 3IC6A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1O6D A;  1VHK A;  2YY8 A;  3AXZ A;  1VH0 A;  4E8B A;  2QWV A;  1V2X A;  1GZ0 A;  2HA8 A;  2CX8 A;  1VHY A;  1X7O A;  1UAK A;  1NS5 A;  1UAL A;  3QUV A;  4CNF B;  1V6Z A;  1X7P A;  3GYQ A;  1K3R A;  1UAM A;  3ILK A;  3KY7 A;  4H3Z A;  3AI9 X;  1P9P A;  3DCM X;  3N4J A;  2QMM A;  3NK6 A;  1UAJ A;  1NXZ A;  1TO0 A;  3NK7 A;  3ONP A;  3N4K A;  2O3A A;  4FAK A;  4H3Y A;  1ZJR A;  2Z0Y A;  1MXI A;  3IEF A;  1J85 A;  4CNG B;  3E5Y A;  3KNU A;  4CNE B;  3KTY A;  2I6D A;  3AIA A;  3L8U A;  4IG6 A;  3IC6 A; 
#chains in the KnotProt database with same CATH topology
 1O6D A;  1VHK A;  2YY8 A;  3AXZ A;  1VH0 A;  4E8B A;  2QWV A;  1V2X A;  1GZ0 A;  2HA8 A;  2CX8 A;  1VHY A;  1X7O A;  1UAK A;  1NS5 A;  1UAL A;  3QUV A;  4CNF B;  1V6Z A;  1X7P A;  3GYQ A;  1K3R A;  1UAM A;  3ILK A;  3KY7 A;  4H3Z A;  3AI9 X;  1P9P A;  3DCM X;  3N4J A;  2QMM A;  3NK6 A;  1UAJ A;  1NXZ A;  1TO0 A;  3NK7 A;  3ONP A;  3N4K A;  2O3A A;  4FAK A;  4H3Y A;  1ZJR A;  2Z0Y A;  1MXI A;  3IEF A;  1J85 A;  4CNG B;  3E5Y A;  3KNU A;  4CNE B;  3KTY A;  2I6D A;  3AIA A;  3L8U A;  4IG6 A;  3IC6 A; 
#chains in the KnotProt database with same CATH homology
 1O6D A;  1VHK A;  2YY8 A;  3AXZ A;  1VH0 A;  4E8B A;  2QWV A;  1V2X A;  1GZ0 A;  2HA8 A;  2CX8 A;  1VHY A;  1X7O A;  1UAK A;  1NS5 A;  1UAL A;  3QUV A;  4CNF B;  1V6Z A;  1X7P A;  3GYQ A;  1K3R A;  1UAM A;  3ILK A;  3KY7 A;  4H3Z A;  3AI9 X;  1P9P A;  3DCM X;  3N4J A;  2QMM A;  3NK6 A;  1UAJ A;  1NXZ A;  1TO0 A;  3NK7 A;  3ONP A;  3N4K A;  2O3A A;  4FAK A;  4H3Y A;  1ZJR A;  2Z0Y A;  1MXI A;  3IEF A;  1J85 A;  4CNG B;  3E5Y A;  3KNU A;  4CNE B;  3KTY A;  2I6D A;  3AIA A;  3L8U A;  4IG6 A;  3IC6 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling