2HA8A

Methyltransferase domain of human tar (hiv-1) rna binding protein 1
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 86-127 42 1-85, 128-159 85 32 knot
Chain Sequence
LGKSISRLIVVASLIDKPTNLGGLCRTCEVFGASVLVVGSLQCISDKQFQHLSVSAEQWLPLVEVKPPQLIDYLQQKKTEGYTIIGVEQTAKSLDLTQYCFPEKSLLLLGNEREGIPANLIQQLDVCVEIPQQGIIRSLNVHVSGALLIWEYTRQQLLS
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 86-128 43 1-85, 129-159 85 31 knot
view details
2.1 85-125 41 1-84 131-159 126-130 84 29 slipknot
view details
3.1 88-147 60 148-159 1-85 86-87 85 11 slipknot
sequence length 159
structure length 159
publication title The Crystal Structure of Methyltransferase Domain of Human TAR (HIV-1) RNA binding protein 1 in complex with S-adenosyl-L-homocystein.
rcsb
molecule tags Rna binding protein
molecule keywords TAR (HIV-1) RNA loop binding protein
source organism Homo sapiens
total genus Genus: 57
ec nomenclature
pdb deposition date 2006-06-12
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 2ha8A01
3IC6A 4FAKA 4IG6A 4CNEB 1TO0A 3KY7A 3AI9X 4CNFB 2HA8A 2QWVA 3L8UA 3GYQA 3NK7A 1NXZA 3NK6A 3N4KA 1P9PA 1MXIA 1UAJA 3QUVA 1X7PA 1UAMA 2I6DA 2QMMA 2O3AA 1GZ0A 2YY8A 1K3RA 3IEFA 3E5YA 4E8BA 1X7OA 3AXZA 1V2XA 1O6DA 4H3ZA 4CNGB 1UALA 3N4JA 4H3YA 3ILKA 1ZJRA 3KTYA 1VH0A 3KNUA 1V6ZA 2Z0YA 1VHKA 3DCMX 1VHYA 2CX8A 3AIAA 1J85A 1UAKA 3ONPA 1NS5A
chains in the KnotProt database with same CATH superfamily
3IC6A 4FAKA 4IG6A 4CNEB 1TO0A 3KY7A 3AI9X 4CNFB 2HA8A 2QWVA 3L8UA 3GYQA 3NK7A 1NXZA 3NK6A 3N4KA 1P9PA 1MXIA 1UAJA 3QUVA 1X7PA 1UAMA 2I6DA 2QMMA 2O3AA 1GZ0A 2YY8A 1K3RA 3IEFA 3E5YA 4E8BA 1X7OA 3AXZA 1V2XA 1O6DA 4H3ZA 4CNGB 1UALA 3N4JA 4H3YA 3ILKA 1ZJRA 3KTYA 1VH0A 3KNUA 1V6ZA 2Z0YA 1VHKA 3DCMX 1VHYA 2CX8A 3AIAA 1J85A 1UAKA 3ONPA 1NS5A
chains in the KnotProt database with same CATH topology
3IC6A 4FAKA 4IG6A 4CNEB 1TO0A 3KY7A 3AI9X 4CNFB 2HA8A 2QWVA 3L8UA 3GYQA 3NK7A 1NXZA 3NK6A 3N4KA 1P9PA 1MXIA 1UAJA 3QUVA 1X7PA 1UAMA 2I6DA 2QMMA 2O3AA 1GZ0A 2YY8A 1K3RA 3IEFA 3E5YA 4E8BA 1X7OA 3AXZA 1V2XA 1O6DA 4H3ZA 4CNGB 1UALA 3N4JA 4H3YA 3ILKA 1ZJRA 3KTYA 1VH0A 3KNUA 1V6ZA 2Z0YA 1VHKA 3DCMX 1VHYA 2CX8A 3AIAA 1J85A 1UAKA 3ONPA 1NS5A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3IC6 A;  4FAK A;  4IG6 A;  4CNE B;  1TO0 A;  3KY7 A;  3AI9 X;  4CNF B;  2HA8 A;  2QWV A;  3L8U A;  3GYQ A;  3NK7 A;  1NXZ A;  3NK6 A;  3N4K A;  1P9P A;  1MXI A;  1UAJ A;  3QUV A;  1X7P A;  1UAM A;  2I6D A;  2QMM A;  2O3A A;  1GZ0 A;  2YY8 A;  1K3R A;  3IEF A;  3E5Y A;  4E8B A;  1X7O A;  3AXZ A;  1V2X A;  1O6D A;  4H3Z A;  4CNG B;  1UAL A;  3N4J A;  4H3Y A;  3ILK A;  1ZJR A;  3KTY A;  1VH0 A;  3KNU A;  1V6Z A;  2Z0Y A;  1VHK A;  3DCM X;  1VHY A;  2CX8 A;  3AIA A;  1J85 A;  1UAK A;  3ONP A;  1NS5 A; 
#chains in the KnotProt database with same CATH topology
 3IC6 A;  4FAK A;  4IG6 A;  4CNE B;  1TO0 A;  3KY7 A;  3AI9 X;  4CNF B;  2HA8 A;  2QWV A;  3L8U A;  3GYQ A;  3NK7 A;  1NXZ A;  3NK6 A;  3N4K A;  1P9P A;  1MXI A;  1UAJ A;  3QUV A;  1X7P A;  1UAM A;  2I6D A;  2QMM A;  2O3A A;  1GZ0 A;  2YY8 A;  1K3R A;  3IEF A;  3E5Y A;  4E8B A;  1X7O A;  3AXZ A;  1V2X A;  1O6D A;  4H3Z A;  4CNG B;  1UAL A;  3N4J A;  4H3Y A;  3ILK A;  1ZJR A;  3KTY A;  1VH0 A;  3KNU A;  1V6Z A;  2Z0Y A;  1VHK A;  3DCM X;  1VHY A;  2CX8 A;  3AIA A;  1J85 A;  1UAK A;  3ONP A;  1NS5 A; 
#chains in the KnotProt database with same CATH homology
 3IC6 A;  4FAK A;  4IG6 A;  4CNE B;  1TO0 A;  3KY7 A;  3AI9 X;  4CNF B;  2HA8 A;  2QWV A;  3L8U A;  3GYQ A;  3NK7 A;  1NXZ A;  3NK6 A;  3N4K A;  1P9P A;  1MXI A;  1UAJ A;  3QUV A;  1X7P A;  1UAM A;  2I6D A;  2QMM A;  2O3A A;  1GZ0 A;  2YY8 A;  1K3R A;  3IEF A;  3E5Y A;  4E8B A;  1X7O A;  3AXZ A;  1V2X A;  1O6D A;  4H3Z A;  4CNG B;  1UAL A;  3N4J A;  4H3Y A;  3ILK A;  1ZJR A;  3KTY A;  1VH0 A;  3KNU A;  1V6Z A;  2Z0Y A;  1VHK A;  3DCM X;  1VHY A;  2CX8 A;  3AIA A;  1J85 A;  1UAK A;  3ONP A;  1NS5 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling