1VHYA

Crystal structure of haemophilus influenzae protein hi0303, pfam duf558
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 168-213 46 1-167, 214-245 167 32 knot
Chain Sequence
IPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKKSVKVEILGRELADKESHLKIHLGQVI----RMEFTIQKSVELGVNVITPLWSERCGVKLDAERMDKKIQQWQKIAIAACEQCGRNIVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSIKTLPTIPAGGVRLLIGSEGGLSAQEIAQTEQQGFTEILLGKRVLRTETASLAAISALQICFGDLGEEG
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 163-210 48 1-162, 211-241 162 31 knot
view details
2.1 154-206 53 1-153 213-241 207-212 153 29 slipknot
view details
3.1 165-211 47 1-162, 219-241 163-164, 212-218 162 23 slipknot
view details
2.1 166-219 54 220-241 1-162 163-165 162 21 slipknot
sequence length 245
structure length 241
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein HI0303
source organism Haemophilus influenzae
missing residues 85-88
total genus Genus: 73
ec nomenclature ec 2.1.1.193: 16S rRNA (uracil(1498)-N(3))-methyltransferase.
pdb deposition date 2003-12-01
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04452 Methyltrans_RNA RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.20 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Hypothetical PUA domain-like; domain 1 1vhyA01
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1vhyA02
1V2XA 4FAKA 1P9PA 3NK6A 2I6DA 4H3YA 4CNFB 3IC6A 2CX8A 1J85A 1MXIA 1X7PA 3AI9X 1VHYA 1O6DA 3QUVA 3AXZA 1K3RA 3ONPA 4E8BA 2O3AA 2QWVA 1X7OA 3KY7A 1UALA 1VHKA 1UAKA 2Z0YA 3KW2A 3ILKA 1NXZA 3KTYA 4CNEB 3N4KA 4IG6A 2YY8A 2HA8A 2QMMA 3IEFA 1IPAA 1TO0A 4CNGB 3E5YA 1V6ZA 1UAJA 3AIAA 3KNUA 1NS5A 3GYQA 3DCMX 3N4JA 3NK7A 1GZ0A 4H3ZA 1VH0A 1UAMA 3L8UA 1ZJRA
chains in the KnotProt database with same CATH superfamily
1V2XA 4FAKA 1P9PA 3NK6A 2I6DA 4H3YA 4CNFB 3IC6A 2CX8A 1J85A 1MXIA 1X7PA 3AI9X 1VHYA 1O6DA 3QUVA 3AXZA 1K3RA 3ONPA 4E8BA 2O3AA 2QWVA 1X7OA 3KY7A 1UALA 1VHKA 1UAKA 2Z0YA 3KW2A 3ILKA 1NXZA 3KTYA 4CNEB 3N4KA 4IG6A 2YY8A 2HA8A 2QMMA 3IEFA 1IPAA 1TO0A 4CNGB 3E5YA 1V6ZA 1UAJA 3AIAA 3KNUA 1NS5A 3GYQA 3DCMX 3N4JA 3NK7A 1GZ0A 4H3ZA 1VH0A 1UAMA 3L8UA 1ZJRA
chains in the KnotProt database with same CATH topology
1V2XA 4FAKA 1P9PA 3NK6A 2I6DA 4H3YA 4CNFB 3IC6A 2CX8A 1J85A 1MXIA 1X7PA 3AI9X 1VHYA 1O6DA 3QUVA 3AXZA 1K3RA 3ONPA 4E8BA 2O3AA 2QWVA 1X7OA 3KY7A 1UALA 1VHKA 1UAKA 2Z0YA 3KW2A 3ILKA 1NXZA 3KTYA 4CNEB 3N4KA 4IG6A 2YY8A 2HA8A 2QMMA 3IEFA 1IPAA 1TO0A 4CNGB 3E5YA 1V6ZA 1UAJA 3AIAA 3KNUA 1NS5A 3GYQA 3DCMX 3N4JA 3NK7A 1GZ0A 4H3ZA 1VH0A 1UAMA 3L8UA 1ZJRA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1V2X A;  4FAK A;  1P9P A;  3NK6 A;  2I6D A;  4H3Y A;  4CNF B;  3IC6 A;  2CX8 A;  1J85 A;  1MXI A;  1X7P A;  3AI9 X;  1VHY A;  1O6D A;  3QUV A;  3AXZ A;  1K3R A;  3ONP A;  4E8B A;  2O3A A;  2QWV A;  1X7O A;  3KY7 A;  1UAL A;  1VHK A;  1UAK A;  2Z0Y A;  3KW2 A;  3ILK A;  1NXZ A;  3KTY A;  4CNE B;  3N4K A;  4IG6 A;  2YY8 A;  2HA8 A;  2QMM A;  3IEF A;  1IPA A;  1TO0 A;  4CNG B;  3E5Y A;  1V6Z A;  1UAJ A;  3AIA A;  3KNU A;  1NS5 A;  3GYQ A;  3DCM X;  3N4J A;  3NK7 A;  1GZ0 A;  4H3Z A;  1VH0 A;  1UAM A;  3L8U A;  1ZJR A; 
#chains in the KnotProt database with same CATH topology
 1V2X A;  4FAK A;  1P9P A;  3NK6 A;  2I6D A;  4H3Y A;  4CNF B;  3IC6 A;  2CX8 A;  1J85 A;  1MXI A;  1X7P A;  3AI9 X;  1VHY A;  1O6D A;  3QUV A;  3AXZ A;  1K3R A;  3ONP A;  4E8B A;  2O3A A;  2QWV A;  1X7O A;  3KY7 A;  1UAL A;  1VHK A;  1UAK A;  2Z0Y A;  3KW2 A;  3ILK A;  1NXZ A;  3KTY A;  4CNE B;  3N4K A;  4IG6 A;  2YY8 A;  2HA8 A;  2QMM A;  3IEF A;  1IPA A;  1TO0 A;  4CNG B;  3E5Y A;  1V6Z A;  1UAJ A;  3AIA A;  3KNU A;  1NS5 A;  3GYQ A;  3DCM X;  3N4J A;  3NK7 A;  1GZ0 A;  4H3Z A;  1VH0 A;  1UAM A;  3L8U A;  1ZJR A; 
#chains in the KnotProt database with same CATH homology
 1V2X A;  4FAK A;  1P9P A;  3NK6 A;  2I6D A;  4H3Y A;  4CNF B;  3IC6 A;  2CX8 A;  1J85 A;  1MXI A;  1X7P A;  3AI9 X;  1VHY A;  1O6D A;  3QUV A;  3AXZ A;  1K3R A;  3ONP A;  4E8B A;  2O3A A;  2QWV A;  1X7O A;  3KY7 A;  1UAL A;  1VHK A;  1UAK A;  2Z0Y A;  3KW2 A;  3ILK A;  1NXZ A;  3KTY A;  4CNE B;  3N4K A;  4IG6 A;  2YY8 A;  2HA8 A;  2QMM A;  3IEF A;  1IPA A;  1TO0 A;  4CNG B;  3E5Y A;  1V6Z A;  1UAJ A;  3AIA A;  3KNU A;  1NS5 A;  3GYQ A;  3DCM X;  3N4J A;  3NK7 A;  1GZ0 A;  4H3Z A;  1VH0 A;  1UAM A;  3L8U A;  1ZJR A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling