4IG6A

Crystal structure of a trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum bound to s-adenosylhomocysteine
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 86-130 45 1-85, 131-223 85 93 knot
Chain Sequence
SMIFNVLTIFPQMFPGPLGVSNLGSALKKGLWTLNVFDIRAFANNKHNTVDDTPYGGGPGMLLRADVLGRCIDEVLSLHPNTKLMFTSPRGVSFTQDIARQTMNFDNITLLCGRFEGIDERVVDFYKLQEVSIGDYVLSGGELAAMVIIDTCVRMVPGVIGNAESLKQESMEGSLEYPQYTRPASWKGMEVPEVLLTGNHGEIEKWRRNASLSITAARRPDLL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 86-132 47 1-85, 133-223 85 91 knot
view details
2.1 84-128 45 1-83 134-223 129-133 83 90 slipknot
view details
2.1 88-157 70 1-85, 166-223 86-87, 158-165 85 58 slipknot
view details
2.1 88-169 82 1-85, 181-223 86-87, 170-180 85 43 slipknot
sequence length 223
structure length 223
publication title Crystal structure of a tRNA (guanine-N1)-methyltransferase from Anaplasma phagocytophilum bound to S-adenosylhomocysteine
rcsb
molecule tags Transferase/transferase inhibitor
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
source organism Anaplasma phagocytophilum
total genus Genus: 66
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2012-12-16
KnotProt deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4ig6A02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4ig6A01
4H3YA 1V6ZA 2CX8A 1VHKA 2QWVA 2QMMA 1VH0A 1UALA 1UAMA 4E8BA 1V2XA 1J85A 3GYQA 4CNEB 1P9PA 1VHYA 3ONPA 3NK7A 1UAKA 3NK6A 1UAJA 1NXZA 4FAKA 3KTYA 3L8UA 4CNFB 4CNGB 3N4JA 1MXIA 2I6DA 3AI9X 4IG6A 1GZ0A 3AXZA 1X7OA 3IEFA 2Z0YA 3QUVA 3DCMX 1IPAA 2O3AA 2HA8A 3N4KA 3KY7A 1ZJRA 3E5YA 1NS5A 1TO0A 4H3ZA 1O6DA 3AIAA 3IC6A 3ILKA 1K3RA 2YY8A 1X7PA 3KNUA
chains in the KnotProt database with same CATH superfamily
4H3YA 1V6ZA 2CX8A 1VHKA 2QWVA 2QMMA 1VH0A 1UALA 1UAMA 4E8BA 1V2XA 1J85A 3GYQA 4CNEB 1P9PA 1VHYA 3ONPA 3NK7A 1UAKA 3NK6A 1UAJA 1NXZA 4FAKA 3KTYA 3L8UA 4CNFB 4CNGB 3N4JA 1MXIA 2I6DA 3AI9X 4IG6A 1GZ0A 3AXZA 1X7OA 3IEFA 2Z0YA 3QUVA 3DCMX 1IPAA 2O3AA 2HA8A 3N4KA 3KY7A 1ZJRA 3E5YA 1NS5A 1TO0A 4H3ZA 1O6DA 3AIAA 3IC6A 3ILKA 1K3RA 2YY8A 1X7PA 3KNUA
chains in the KnotProt database with same CATH topology
4H3YA 1V6ZA 2CX8A 1VHKA 2QWVA 2QMMA 1VH0A 1UALA 1UAMA 4E8BA 1V2XA 1J85A 3GYQA 4CNEB 1P9PA 1VHYA 3ONPA 3NK7A 1UAKA 3NK6A 1UAJA 1NXZA 4FAKA 3KTYA 3L8UA 4CNFB 4CNGB 3N4JA 1MXIA 2I6DA 3AI9X 4IG6A 1GZ0A 3AXZA 1X7OA 3IEFA 2Z0YA 3QUVA 3DCMX 1IPAA 2O3AA 2HA8A 3N4KA 3KY7A 1ZJRA 3E5YA 1NS5A 1TO0A 4H3ZA 1O6DA 3AIAA 3IC6A 3ILKA 1K3RA 2YY8A 1X7PA 3KNUA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 4H3Y A;  1V6Z A;  2CX8 A;  1VHK A;  2QWV A;  2QMM A;  1VH0 A;  1UAL A;  1UAM A;  4E8B A;  1V2X A;  1J85 A;  3GYQ A;  4CNE B;  1P9P A;  1VHY A;  3ONP A;  3NK7 A;  1UAK A;  3NK6 A;  1UAJ A;  1NXZ A;  4FAK A;  3KTY A;  3L8U A;  4CNF B;  4CNG B;  3N4J A;  1MXI A;  2I6D A;  3AI9 X;  4IG6 A;  1GZ0 A;  3AXZ A;  1X7O A;  3IEF A;  2Z0Y A;  3QUV A;  3DCM X;  1IPA A;  2O3A A;  2HA8 A;  3N4K A;  3KY7 A;  1ZJR A;  3E5Y A;  1NS5 A;  1TO0 A;  4H3Z A;  1O6D A;  3AIA A;  3IC6 A;  3ILK A;  1K3R A;  2YY8 A;  1X7P A;  3KNU A; 
#chains in the KnotProt database with same CATH topology
 4H3Y A;  1V6Z A;  2CX8 A;  1VHK A;  2QWV A;  2QMM A;  1VH0 A;  1UAL A;  1UAM A;  4E8B A;  1V2X A;  1J85 A;  3GYQ A;  4CNE B;  1P9P A;  1VHY A;  3ONP A;  3NK7 A;  1UAK A;  3NK6 A;  1UAJ A;  1NXZ A;  4FAK A;  3KTY A;  3L8U A;  4CNF B;  4CNG B;  3N4J A;  1MXI A;  2I6D A;  3AI9 X;  4IG6 A;  1GZ0 A;  3AXZ A;  1X7O A;  3IEF A;  2Z0Y A;  3QUV A;  3DCM X;  1IPA A;  2O3A A;  2HA8 A;  3N4K A;  3KY7 A;  1ZJR A;  3E5Y A;  1NS5 A;  1TO0 A;  4H3Z A;  1O6D A;  3AIA A;  3IC6 A;  3ILK A;  1K3R A;  2YY8 A;  1X7P A;  3KNU A; 
#chains in the KnotProt database with same CATH homology
 4H3Y A;  1V6Z A;  2CX8 A;  1VHK A;  2QWV A;  2QMM A;  1VH0 A;  1UAL A;  1UAM A;  4E8B A;  1V2X A;  1J85 A;  3GYQ A;  4CNE B;  1P9P A;  1VHY A;  3ONP A;  3NK7 A;  1UAK A;  3NK6 A;  1UAJ A;  1NXZ A;  4FAK A;  3KTY A;  3L8U A;  4CNF B;  4CNG B;  3N4J A;  1MXI A;  2I6D A;  3AI9 X;  4IG6 A;  1GZ0 A;  3AXZ A;  1X7O A;  3IEF A;  2Z0Y A;  3QUV A;  3DCM X;  1IPA A;  2O3A A;  2HA8 A;  3N4K A;  3KY7 A;  1ZJR A;  3E5Y A;  1NS5 A;  1TO0 A;  4H3Z A;  1O6D A;  3AIA A;  3IC6 A;  3ILK A;  1K3R A;  2YY8 A;  1X7P A;  3KNU A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling