1NXZA

X-ray crystal structure of protein yggj_haein of haemophilus influenzae. northeast structural genomics consortium target ir73.
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 169-214 46 1-168, 215-246 168 32 knot
Chain Sequence
RIPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKKSVKVEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKLDAERMDKKIQQWQKIAIAACEQCGRNIVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSIKTLPTIPAGGVRLLIGSEGGLSAQEIAQTEQQGFTEILLGKRVLRTETASLAAISALQICFGDLGEAA
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 167-215 49 1-166, 216-246 166 31 knot
view details
2.1 159-211 53 1-158 218-246 212-217 158 29 slipknot
view details
3.1 168-215 48 1-166, 231-246 167-167, 216-230 166 16 slipknot
view details
3.1 170-217 48 1-166, 236-246 167-169, 218-235 166 11 slipknot
view details
2.1 170-241 72 242-246 1-166 167-169 166 4 slipknot
sequence length 246
structure length 246
publication title Functional assignment based on structural analysis: crystal structure of the yggJ protein (HI0303) of Haemophilus influenzae reveals an RNA methyltransferase with a deep trefoil knot.
pubmed doi rcsb
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein HI0303
source organism Haemophilus influenzae
total genus Genus: 67
ec nomenclature ec 2.1.1.193: 16S rRNA (uracil(1498)-N(3))-methyltransferase.
pdb deposition date 2003-02-11
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04452 Methyltrans_RNA RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.20 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Hypothetical PUA domain-like; domain 1 1nxzA01
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1nxzA02
3E5YA 4E8BA 2O3AA 3AI9X 3IEFA 3KY7A 1V6ZA 3N4KA 1UAMA 1O6DA 1ZJRA 1UAKA 3L8UA 3NK7A 3KNUA 1TO0A 3KW2A 1V2XA 4CNFB 1VHYA 1X7OA 1NXZA 1VHKA 1P9PA 1VH0A 3IC6A 3AXZA 3ILKA 1NS5A 3ONPA 1X7PA 2QMMA 3DCMX 2I6DA 3NK6A 1GZ0A 2HA8A 4FAKA 4IG6A 1UALA 1J85A 4H3YA 3KTYA 2CX8A 3GYQA 3N4JA 3QUVA 1K3RA 2YY8A 3AIAA 2QWVA 4H3ZA 4CNGB 2Z0YA 4CNEB 1UAJA 1MXIA
chains in the KnotProt database with same CATH superfamily
3E5YA 4E8BA 2O3AA 3AI9X 3IEFA 3KY7A 1V6ZA 3N4KA 1UAMA 1O6DA 1ZJRA 1UAKA 3L8UA 3NK7A 3KNUA 1TO0A 3KW2A 1V2XA 4CNFB 1VHYA 1X7OA 1NXZA 1VHKA 1P9PA 1VH0A 3IC6A 3AXZA 3ILKA 1NS5A 3ONPA 1X7PA 2QMMA 3DCMX 2I6DA 3NK6A 1GZ0A 2HA8A 4FAKA 4IG6A 1UALA 1J85A 4H3YA 3KTYA 2CX8A 3GYQA 3N4JA 3QUVA 1K3RA 2YY8A 3AIAA 2QWVA 4H3ZA 4CNGB 2Z0YA 4CNEB 1UAJA 1MXIA
chains in the KnotProt database with same CATH topology
3E5YA 4E8BA 2O3AA 3AI9X 3IEFA 3KY7A 1V6ZA 3N4KA 1UAMA 1O6DA 1ZJRA 1UAKA 3L8UA 3NK7A 3KNUA 1TO0A 3KW2A 1V2XA 4CNFB 1VHYA 1X7OA 1NXZA 1VHKA 1P9PA 1VH0A 3IC6A 3AXZA 3ILKA 1NS5A 3ONPA 1X7PA 2QMMA 3DCMX 2I6DA 3NK6A 1GZ0A 2HA8A 4FAKA 4IG6A 1UALA 1J85A 4H3YA 3KTYA 2CX8A 3GYQA 3N4JA 3QUVA 1K3RA 2YY8A 3AIAA 2QWVA 4H3ZA 4CNGB 2Z0YA 4CNEB 1UAJA 1MXIA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3E5Y A;  4E8B A;  2O3A A;  3AI9 X;  3IEF A;  3KY7 A;  1V6Z A;  3N4K A;  1UAM A;  1O6D A;  1ZJR A;  1UAK A;  3L8U A;  3NK7 A;  3KNU A;  1TO0 A;  3KW2 A;  1V2X A;  4CNF B;  1VHY A;  1X7O A;  1NXZ A;  1VHK A;  1P9P A;  1VH0 A;  3IC6 A;  3AXZ A;  3ILK A;  1NS5 A;  3ONP A;  1X7P A;  2QMM A;  3DCM X;  2I6D A;  3NK6 A;  1GZ0 A;  2HA8 A;  4FAK A;  4IG6 A;  1UAL A;  1J85 A;  4H3Y A;  3KTY A;  2CX8 A;  3GYQ A;  3N4J A;  3QUV A;  1K3R A;  2YY8 A;  3AIA A;  2QWV A;  4H3Z A;  4CNG B;  2Z0Y A;  4CNE B;  1UAJ A;  1MXI A; 
#chains in the KnotProt database with same CATH topology
 3E5Y A;  4E8B A;  2O3A A;  3AI9 X;  3IEF A;  3KY7 A;  1V6Z A;  3N4K A;  1UAM A;  1O6D A;  1ZJR A;  1UAK A;  3L8U A;  3NK7 A;  3KNU A;  1TO0 A;  3KW2 A;  1V2X A;  4CNF B;  1VHY A;  1X7O A;  1NXZ A;  1VHK A;  1P9P A;  1VH0 A;  3IC6 A;  3AXZ A;  3ILK A;  1NS5 A;  3ONP A;  1X7P A;  2QMM A;  3DCM X;  2I6D A;  3NK6 A;  1GZ0 A;  2HA8 A;  4FAK A;  4IG6 A;  1UAL A;  1J85 A;  4H3Y A;  3KTY A;  2CX8 A;  3GYQ A;  3N4J A;  3QUV A;  1K3R A;  2YY8 A;  3AIA A;  2QWV A;  4H3Z A;  4CNG B;  2Z0Y A;  4CNE B;  1UAJ A;  1MXI A; 
#chains in the KnotProt database with same CATH homology
 3E5Y A;  4E8B A;  2O3A A;  3AI9 X;  3IEF A;  3KY7 A;  1V6Z A;  3N4K A;  1UAM A;  1O6D A;  1ZJR A;  1UAK A;  3L8U A;  3NK7 A;  3KNU A;  1TO0 A;  3KW2 A;  1V2X A;  4CNF B;  1VHY A;  1X7O A;  1NXZ A;  1VHK A;  1P9P A;  1VH0 A;  3IC6 A;  3AXZ A;  3ILK A;  1NS5 A;  3ONP A;  1X7P A;  2QMM A;  3DCM X;  2I6D A;  3NK6 A;  1GZ0 A;  2HA8 A;  4FAK A;  4IG6 A;  1UAL A;  1J85 A;  4H3Y A;  3KTY A;  2CX8 A;  3GYQ A;  3N4J A;  3QUV A;  1K3R A;  2YY8 A;  3AIA A;  2QWV A;  4H3Z A;  4CNG B;  2Z0Y A;  4CNE B;  1UAJ A;  1MXI A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling