4CNFB

Crystal structure of sulfolobus acidocaldarius trmj
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 75-127 53 1-74, 128-156 74 29 knot
Chain Sequence
MTIRLVIVEPEGAYNLGFIARLVKNFLIDEFYVVNPKADINEAIKFSAKGSEVIEKMMKITNNFDDAIRDVDLKIATSSIADI-----RKSIRPIDLERLIKDKKVAFIFGRESVGLTREEIAKSDFLLFIPANPEYPVLNLSHAVGIVLYELWRN
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 76-124 49 1-75, 125-151 75 27 knot
view details
2.1 74-120 47 1-73 127-151 121-126 73 25 slipknot
sequence length 156
structure length 151
publication title Characterization of Two Homologous 2'-O-Methyltransferases Showing Different Specificities for Their tRNA Substrates.
pubmed doi rcsb
molecule tags Transferase
molecule keywords SPOU RRNA METHYLASE
source organism Sulfolobus acidocaldarius
missing residues 84-88
ec nomenclature ec 2.1.1.200: tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase.
pdb deposition date 2014-01-22
KnotProt deposition date 2018-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4cnfB00
4CNEB 3AIAA 3N4JA 1V2XA 1TO0A 3ONPA 1UAJA 1VHYA 3N4KA 1V6ZA 3GYQA 4CNGB 2O3AA 3IEFA 1UAKA 1MXIA 3ILKA 3L8UA 2I6DA 1O6DA 1NXZA 1X7OA 3DCMX 2QMMA 2CX8A 4H3YA 3KY7A 4IG6A 1UALA 1VHKA 3NK7A 2Z0YA 1J85A 2YY8A 1K3RA 1VH0A 4FAKA 1UAMA 3QUVA 1NS5A 1X7PA 3AI9X 3NK6A 4CNFB 4E8BA 3IC6A 1ZJRA 3E5YA 1GZ0A 3KTYA 3KNUA 3AXZA 2QWVA 1P9PA 4H3ZA 2HA8A
chains in the KnotProt database with same CATH superfamily
4CNEB 3AIAA 3N4JA 1V2XA 1TO0A 3ONPA 1UAJA 1VHYA 3N4KA 1V6ZA 3GYQA 4CNGB 2O3AA 3IEFA 1UAKA 1MXIA 3ILKA 3L8UA 2I6DA 1O6DA 1NXZA 1X7OA 3DCMX 2QMMA 2CX8A 4H3YA 3KY7A 4IG6A 1UALA 1VHKA 3NK7A 2Z0YA 1J85A 2YY8A 1K3RA 1VH0A 4FAKA 1UAMA 3QUVA 1NS5A 1X7PA 3AI9X 3NK6A 4CNFB 4E8BA 3IC6A 1ZJRA 3E5YA 1GZ0A 3KTYA 3KNUA 3AXZA 2QWVA 1P9PA 4H3ZA 2HA8A
chains in the KnotProt database with same CATH topology
4CNEB 3AIAA 3N4JA 1V2XA 1TO0A 3ONPA 1UAJA 1VHYA 3N4KA 1V6ZA 3GYQA 4CNGB 2O3AA 3IEFA 1UAKA 1MXIA 3ILKA 3L8UA 2I6DA 1O6DA 1NXZA 1X7OA 3DCMX 2QMMA 2CX8A 4H3YA 3KY7A 4IG6A 1UALA 1VHKA 3NK7A 2Z0YA 1J85A 2YY8A 1K3RA 1VH0A 4FAKA 1UAMA 3QUVA 1NS5A 1X7PA 3AI9X 3NK6A 4CNFB 4E8BA 3IC6A 1ZJRA 3E5YA 1GZ0A 3KTYA 3KNUA 3AXZA 2QWVA 1P9PA 4H3ZA 2HA8A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 4CNE B;  3AIA A;  3N4J A;  1V2X A;  1TO0 A;  3ONP A;  1UAJ A;  1VHY A;  3N4K A;  1V6Z A;  3GYQ A;  4CNG B;  2O3A A;  3IEF A;  1UAK A;  1MXI A;  3ILK A;  3L8U A;  2I6D A;  1O6D A;  1NXZ A;  1X7O A;  3DCM X;  2QMM A;  2CX8 A;  4H3Y A;  3KY7 A;  4IG6 A;  1UAL A;  1VHK A;  3NK7 A;  2Z0Y A;  1J85 A;  2YY8 A;  1K3R A;  1VH0 A;  4FAK A;  1UAM A;  3QUV A;  1NS5 A;  1X7P A;  3AI9 X;  3NK6 A;  4CNF B;  4E8B A;  3IC6 A;  1ZJR A;  3E5Y A;  1GZ0 A;  3KTY A;  3KNU A;  3AXZ A;  2QWV A;  1P9P A;  4H3Z A;  2HA8 A; 
#chains in the KnotProt database with same CATH topology
 4CNE B;  3AIA A;  3N4J A;  1V2X A;  1TO0 A;  3ONP A;  1UAJ A;  1VHY A;  3N4K A;  1V6Z A;  3GYQ A;  4CNG B;  2O3A A;  3IEF A;  1UAK A;  1MXI A;  3ILK A;  3L8U A;  2I6D A;  1O6D A;  1NXZ A;  1X7O A;  3DCM X;  2QMM A;  2CX8 A;  4H3Y A;  3KY7 A;  4IG6 A;  1UAL A;  1VHK A;  3NK7 A;  2Z0Y A;  1J85 A;  2YY8 A;  1K3R A;  1VH0 A;  4FAK A;  1UAM A;  3QUV A;  1NS5 A;  1X7P A;  3AI9 X;  3NK6 A;  4CNF B;  4E8B A;  3IC6 A;  1ZJR A;  3E5Y A;  1GZ0 A;  3KTY A;  3KNU A;  3AXZ A;  2QWV A;  1P9P A;  4H3Z A;  2HA8 A; 
#chains in the KnotProt database with same CATH homology
 4CNE B;  3AIA A;  3N4J A;  1V2X A;  1TO0 A;  3ONP A;  1UAJ A;  1VHY A;  3N4K A;  1V6Z A;  3GYQ A;  4CNG B;  2O3A A;  3IEF A;  1UAK A;  1MXI A;  3ILK A;  3L8U A;  2I6D A;  1O6D A;  1NXZ A;  1X7O A;  3DCM X;  2QMM A;  2CX8 A;  4H3Y A;  3KY7 A;  4IG6 A;  1UAL A;  1VHK A;  3NK7 A;  2Z0Y A;  1J85 A;  2YY8 A;  1K3R A;  1VH0 A;  4FAK A;  1UAM A;  3QUV A;  1NS5 A;  1X7P A;  3AI9 X;  3NK6 A;  4CNF B;  4E8B A;  3IC6 A;  1ZJR A;  3E5Y A;  1GZ0 A;  3KTY A;  3KNU A;  3AXZ A;  2QWV A;  1P9P A;  4H3Z A;  2HA8 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling