4CNFB

Crystal structure of sulfolobus acidocaldarius trmj
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 75-127 53 1-74, 128-156 74 29 knot
Chain Sequence
MTIRLVIVEPEGAYNLGFIARLVKNFLIDEFYVVNPKADINEAIKFSAKGSEVIEKMMKITNNFDDAIRDVDLKIATSSIADI-----RKSIRPIDLERLIKDKKVAFIFGRESVGLTREEIAKSDFLLFIPANPEYPVLNLSHAVGIVLYELWRN
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 76-124 49 1-75, 125-151 75 27 knot
view details
2.1 74-120 47 1-73 127-151 121-126 73 25 slipknot
sequence length 156
structure length 151
publication title Characterization of Two Homologous 2'-O-Methyltransferases Showing Different Specificities for Their tRNA Substrates.
pubmed doi rcsb
molecule tags Transferase
molecule keywords SPOU RRNA METHYLASE
source organism Sulfolobus acidocaldarius
missing residues 84-88
ec nomenclature ec 2.1.1.200: tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase.
pdb deposition date 2014-01-22
KnotProt deposition date 2018-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4cnfB00
1K3RA 1NXZA 3GYQA 1VHKA 3E5YA 1VH0A 3ONPA 3KNUA 3KTYA 2YY8A 1O6DA 2QMMA 1MXIA 4CNEB 3AXZA 4CNGB 1X7OA 1NS5A 2Z0YA 3ILKA 3NK6A 1TO0A 1ZJRA 4FAKA 4H3YA 2HA8A 3IEFA 1V6ZA 1X7PA 4CNFB 2CX8A 1UAKA 3KY7A 3IC6A 3AI9X 3QUVA 1GZ0A 1V2XA 2I6DA 3DCMX 3L8UA 1UAJA 1VHYA 4IG6A 1UALA 1P9PA 3N4JA 1UAMA 1J85A 2QWVA 4E8BA 2O3AA 3N4KA 4H3ZA 3NK7A 3AIAA
chains in the KnotProt database with same CATH superfamily
1K3RA 1NXZA 3GYQA 1VHKA 3E5YA 1VH0A 3ONPA 3KNUA 3KTYA 2YY8A 1O6DA 2QMMA 1MXIA 4CNEB 3AXZA 4CNGB 1X7OA 1NS5A 2Z0YA 3ILKA 3NK6A 1TO0A 1ZJRA 4FAKA 4H3YA 2HA8A 3IEFA 1V6ZA 1X7PA 4CNFB 2CX8A 1UAKA 3KY7A 3IC6A 3AI9X 3QUVA 1GZ0A 1V2XA 2I6DA 3DCMX 3L8UA 1UAJA 1VHYA 4IG6A 1UALA 1P9PA 3N4JA 1UAMA 1J85A 2QWVA 4E8BA 2O3AA 3N4KA 4H3ZA 3NK7A 3AIAA
chains in the KnotProt database with same CATH topology
1K3RA 1NXZA 3GYQA 1VHKA 3E5YA 1VH0A 3ONPA 3KNUA 3KTYA 2YY8A 1O6DA 2QMMA 1MXIA 4CNEB 3AXZA 4CNGB 1X7OA 1NS5A 2Z0YA 3ILKA 3NK6A 1TO0A 1ZJRA 4FAKA 4H3YA 2HA8A 3IEFA 1V6ZA 1X7PA 4CNFB 2CX8A 1UAKA 3KY7A 3IC6A 3AI9X 3QUVA 1GZ0A 1V2XA 2I6DA 3DCMX 3L8UA 1UAJA 1VHYA 4IG6A 1UALA 1P9PA 3N4JA 1UAMA 1J85A 2QWVA 4E8BA 2O3AA 3N4KA 4H3ZA 3NK7A 3AIAA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1K3R A;  1NXZ A;  3GYQ A;  1VHK A;  3E5Y A;  1VH0 A;  3ONP A;  3KNU A;  3KTY A;  2YY8 A;  1O6D A;  2QMM A;  1MXI A;  4CNE B;  3AXZ A;  4CNG B;  1X7O A;  1NS5 A;  2Z0Y A;  3ILK A;  3NK6 A;  1TO0 A;  1ZJR A;  4FAK A;  4H3Y A;  2HA8 A;  3IEF A;  1V6Z A;  1X7P A;  4CNF B;  2CX8 A;  1UAK A;  3KY7 A;  3IC6 A;  3AI9 X;  3QUV A;  1GZ0 A;  1V2X A;  2I6D A;  3DCM X;  3L8U A;  1UAJ A;  1VHY A;  4IG6 A;  1UAL A;  1P9P A;  3N4J A;  1UAM A;  1J85 A;  2QWV A;  4E8B A;  2O3A A;  3N4K A;  4H3Z A;  3NK7 A;  3AIA A; 
#chains in the KnotProt database with same CATH topology
 1K3R A;  1NXZ A;  3GYQ A;  1VHK A;  3E5Y A;  1VH0 A;  3ONP A;  3KNU A;  3KTY A;  2YY8 A;  1O6D A;  2QMM A;  1MXI A;  4CNE B;  3AXZ A;  4CNG B;  1X7O A;  1NS5 A;  2Z0Y A;  3ILK A;  3NK6 A;  1TO0 A;  1ZJR A;  4FAK A;  4H3Y A;  2HA8 A;  3IEF A;  1V6Z A;  1X7P A;  4CNF B;  2CX8 A;  1UAK A;  3KY7 A;  3IC6 A;  3AI9 X;  3QUV A;  1GZ0 A;  1V2X A;  2I6D A;  3DCM X;  3L8U A;  1UAJ A;  1VHY A;  4IG6 A;  1UAL A;  1P9P A;  3N4J A;  1UAM A;  1J85 A;  2QWV A;  4E8B A;  2O3A A;  3N4K A;  4H3Z A;  3NK7 A;  3AIA A; 
#chains in the KnotProt database with same CATH homology
 1K3R A;  1NXZ A;  3GYQ A;  1VHK A;  3E5Y A;  1VH0 A;  3ONP A;  3KNU A;  3KTY A;  2YY8 A;  1O6D A;  2QMM A;  1MXI A;  4CNE B;  3AXZ A;  4CNG B;  1X7O A;  1NS5 A;  2Z0Y A;  3ILK A;  3NK6 A;  1TO0 A;  1ZJR A;  4FAK A;  4H3Y A;  2HA8 A;  3IEF A;  1V6Z A;  1X7P A;  4CNF B;  2CX8 A;  1UAK A;  3KY7 A;  3IC6 A;  3AI9 X;  3QUV A;  1GZ0 A;  1V2X A;  2I6D A;  3DCM X;  3L8U A;  1UAJ A;  1VHY A;  4IG6 A;  1UAL A;  1P9P A;  3N4J A;  1UAM A;  1J85 A;  2QWV A;  4E8B A;  2O3A A;  3N4K A;  4H3Z A;  3NK7 A;  3AIA A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling