2YY8A

Crystal structure of archaeal trna-methylase for position 56 (atrm56) from pyrococcus horikoshii, complexed with s-adenosyl-l-methionine
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 80-124 45 1-79, 125-175 79 51 knot
Chain Sequence
MIVVLRLGHRPE-DKRVTTHVALTARAFGADGIIIASEEDEKVKESVEDVVKRWGGPFFIEFNRNWRKVMKEFTGVKVHLTMYGLHVDDVIEELKEKLKKGEDFMIIVGAEKVPREVYELADYNVAIGNQPHSEVAALAVLLDRLLEGKGLKKEFKGAKIKIVPQARGKKVVEVQ
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 77-124 48 1-76, 125-174 76 50 knot
view details
3.1 78-129 52 1-76, 147-174 77-77, 130-146 76 28 slipknot
sequence length 175
structure length 174
publication title Crystal structure and mutational study of a unique SpoU family archaeal methylase that forms 2'-O-methylcytidine at position 56 of tRNA
pubmed doi rcsb
molecule tags Transferase
molecule keywords UPF0106 protein PH0461
source organism Pyrococcus horikoshii
missing residues 13
total genus Genus: 54
ec nomenclature ec 2.1.1.206: tRNA (cytidine(56)-2'-O)-methyltransferase.
pdb deposition date 2007-04-27
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01994 Trm56 tRNA ribose 2'-O-methyltransferase, aTrm56
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 2yy8A00
3E5YA 4E8BA 2O3AA 3AI9X 3IEFA 3KY7A 1V6ZA 3N4KA 1UAMA 1O6DA 1ZJRA 1UAKA 3L8UA 3NK7A 3KNUA 1TO0A 1V2XA 4CNFB 1VHYA 1X7OA 1NXZA 1VH0A 1P9PA 1VHKA 3IC6A 3AXZA 3ILKA 1NS5A 3ONPA 1X7PA 2QMMA 3DCMX 2I6DA 3NK6A 1GZ0A 2HA8A 4FAKA 4IG6A 1UALA 1J85A 4H3YA 3KTYA 2CX8A 3GYQA 3N4JA 3QUVA 1K3RA 2YY8A 3AIAA 2QWVA 4H3ZA 4CNGB 2Z0YA 4CNEB 1UAJA 1MXIA
chains in the KnotProt database with same CATH superfamily
3E5YA 4E8BA 2O3AA 3AI9X 3IEFA 3KY7A 1V6ZA 3N4KA 1UAMA 1O6DA 1ZJRA 1UAKA 3L8UA 3NK7A 3KNUA 1TO0A 1V2XA 4CNFB 1VHYA 1X7OA 1NXZA 1VH0A 1P9PA 1VHKA 3IC6A 3AXZA 3ILKA 1NS5A 3ONPA 1X7PA 2QMMA 3DCMX 2I6DA 3NK6A 1GZ0A 2HA8A 4FAKA 4IG6A 1UALA 1J85A 4H3YA 3KTYA 2CX8A 3GYQA 3N4JA 3QUVA 1K3RA 2YY8A 3AIAA 2QWVA 4H3ZA 4CNGB 2Z0YA 4CNEB 1UAJA 1MXIA
chains in the KnotProt database with same CATH topology
3E5YA 4E8BA 2O3AA 3AI9X 3IEFA 3KY7A 1V6ZA 3N4KA 1UAMA 1O6DA 1ZJRA 1UAKA 3L8UA 3NK7A 3KNUA 1TO0A 1V2XA 4CNFB 1VHYA 1X7OA 1NXZA 1VH0A 1P9PA 1VHKA 3IC6A 3AXZA 3ILKA 1NS5A 3ONPA 1X7PA 2QMMA 3DCMX 2I6DA 3NK6A 1GZ0A 2HA8A 4FAKA 4IG6A 1UALA 1J85A 4H3YA 3KTYA 2CX8A 3GYQA 3N4JA 3QUVA 1K3RA 2YY8A 3AIAA 2QWVA 4H3ZA 4CNGB 2Z0YA 4CNEB 1UAJA 1MXIA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3E5Y A;  4E8B A;  2O3A A;  3AI9 X;  3IEF A;  3KY7 A;  1V6Z A;  3N4K A;  1UAM A;  1O6D A;  1ZJR A;  1UAK A;  3L8U A;  3NK7 A;  3KNU A;  1TO0 A;  1V2X A;  4CNF B;  1VHY A;  1X7O A;  1NXZ A;  1VH0 A;  1P9P A;  1VHK A;  3IC6 A;  3AXZ A;  3ILK A;  1NS5 A;  3ONP A;  1X7P A;  2QMM A;  3DCM X;  2I6D A;  3NK6 A;  1GZ0 A;  2HA8 A;  4FAK A;  4IG6 A;  1UAL A;  1J85 A;  4H3Y A;  3KTY A;  2CX8 A;  3GYQ A;  3N4J A;  3QUV A;  1K3R A;  2YY8 A;  3AIA A;  2QWV A;  4H3Z A;  4CNG B;  2Z0Y A;  4CNE B;  1UAJ A;  1MXI A; 
#chains in the KnotProt database with same CATH topology
 3E5Y A;  4E8B A;  2O3A A;  3AI9 X;  3IEF A;  3KY7 A;  1V6Z A;  3N4K A;  1UAM A;  1O6D A;  1ZJR A;  1UAK A;  3L8U A;  3NK7 A;  3KNU A;  1TO0 A;  1V2X A;  4CNF B;  1VHY A;  1X7O A;  1NXZ A;  1VH0 A;  1P9P A;  1VHK A;  3IC6 A;  3AXZ A;  3ILK A;  1NS5 A;  3ONP A;  1X7P A;  2QMM A;  3DCM X;  2I6D A;  3NK6 A;  1GZ0 A;  2HA8 A;  4FAK A;  4IG6 A;  1UAL A;  1J85 A;  4H3Y A;  3KTY A;  2CX8 A;  3GYQ A;  3N4J A;  3QUV A;  1K3R A;  2YY8 A;  3AIA A;  2QWV A;  4H3Z A;  4CNG B;  2Z0Y A;  4CNE B;  1UAJ A;  1MXI A; 
#chains in the KnotProt database with same CATH homology
 3E5Y A;  4E8B A;  2O3A A;  3AI9 X;  3IEF A;  3KY7 A;  1V6Z A;  3N4K A;  1UAM A;  1O6D A;  1ZJR A;  1UAK A;  3L8U A;  3NK7 A;  3KNU A;  1TO0 A;  1V2X A;  4CNF B;  1VHY A;  1X7O A;  1NXZ A;  1VH0 A;  1P9P A;  1VHK A;  3IC6 A;  3AXZ A;  3ILK A;  1NS5 A;  3ONP A;  1X7P A;  2QMM A;  3DCM X;  2I6D A;  3NK6 A;  1GZ0 A;  2HA8 A;  4FAK A;  4IG6 A;  1UAL A;  1J85 A;  4H3Y A;  3KTY A;  2CX8 A;  3GYQ A;  3N4J A;  3QUV A;  1K3R A;  2YY8 A;  3AIA A;  2QWV A;  4H3Z A;  4CNG B;  2Z0Y A;  4CNE B;  1UAJ A;  1MXI A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling