3AI9X

Crystal structure of duf358 protein reveals a putative spout-class rrna methyltransferase
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 141-182 42 1-140, 183-211 140 29 knot
Chain Sequence
GSHMASMREFIFKANKTITSSDINLKDLPGSCGRLDLLCRCVSDAFFLSHDIRRDVVFYAVLYGQPNPPVCIKFVGSELKKVSPDERNIAIFIKKALKKFEELDEEQRKDWNQSTPGIYVRRLGFRNLVLEKLEEGKNIYYLHMNGEDVENVDIENPVFIIGDHIGIGEEDERFLDEIKAKRISLSPLELHANHCMTMMHNVLDKKRICEI
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 140-183 44 1-139, 184-211 139 28 knot
sequence length 211
structure length 211
publication title Crystal structure of Mj1640/DUF358 protein reveals a putative SPOUT-class RNA methyltransferase
pubmed doi rcsb
molecule tags Transferase
molecule keywords UPF0217 protein MJ1640
source organism Methanocaldococcus jannaschii
total genus Genus: 64
ec nomenclature ec 2.1.1.257: tRNA (pseudouridine(54)-N(1))-methyltransferase.
pdb deposition date 2010-05-11
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF04013 Methyltrn_RNA_2 Putative SAM-dependent RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3ai9X00
1K3RA 1NXZA 3GYQA 1VHKA 3E5YA 1VH0A 3ONPA 3KNUA 3KTYA 2YY8A 1O6DA 2QMMA 1MXIA 4CNEB 3AXZA 4CNGB 1X7OA 1NS5A 2Z0YA 3ILKA 3NK6A 1TO0A 1ZJRA 4FAKA 4H3YA 2HA8A 3IEFA 1V6ZA 1X7PA 4CNFB 2CX8A 1UAKA 3KY7A 3IC6A 3AI9X 3QUVA 1GZ0A 1V2XA 2I6DA 3DCMX 3L8UA 1UAJA 1VHYA 4IG6A 1UALA 1P9PA 3N4JA 1UAMA 1J85A 2QWVA 4E8BA 2O3AA 3N4KA 4H3ZA 3NK7A 3AIAA
chains in the KnotProt database with same CATH superfamily
1K3RA 1NXZA 3GYQA 1VHKA 3E5YA 1VH0A 3ONPA 3KNUA 3KTYA 2YY8A 1O6DA 2QMMA 1MXIA 4CNEB 3AXZA 4CNGB 1X7OA 1NS5A 2Z0YA 3ILKA 3NK6A 1TO0A 1ZJRA 4FAKA 4H3YA 2HA8A 3IEFA 1V6ZA 1X7PA 4CNFB 2CX8A 1UAKA 3KY7A 3IC6A 3AI9X 3QUVA 1GZ0A 1V2XA 2I6DA 3DCMX 3L8UA 1UAJA 1VHYA 4IG6A 1UALA 1P9PA 3N4JA 1UAMA 1J85A 2QWVA 4E8BA 2O3AA 3N4KA 4H3ZA 3NK7A 3AIAA
chains in the KnotProt database with same CATH topology
1K3RA 1NXZA 3GYQA 1VHKA 3E5YA 1VH0A 3ONPA 3KNUA 3KTYA 2YY8A 1O6DA 2QMMA 1MXIA 4CNEB 3AXZA 4CNGB 1X7OA 1NS5A 2Z0YA 3ILKA 3NK6A 1TO0A 1ZJRA 4FAKA 4H3YA 2HA8A 3IEFA 1V6ZA 1X7PA 4CNFB 2CX8A 1UAKA 3KY7A 3IC6A 3AI9X 3QUVA 1GZ0A 1V2XA 2I6DA 3DCMX 3L8UA 1UAJA 1VHYA 4IG6A 1UALA 1P9PA 3N4JA 1UAMA 1J85A 2QWVA 4E8BA 2O3AA 3N4KA 4H3ZA 3NK7A 3AIAA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1K3R A;  1NXZ A;  3GYQ A;  1VHK A;  3E5Y A;  1VH0 A;  3ONP A;  3KNU A;  3KTY A;  2YY8 A;  1O6D A;  2QMM A;  1MXI A;  4CNE B;  3AXZ A;  4CNG B;  1X7O A;  1NS5 A;  2Z0Y A;  3ILK A;  3NK6 A;  1TO0 A;  1ZJR A;  4FAK A;  4H3Y A;  2HA8 A;  3IEF A;  1V6Z A;  1X7P A;  4CNF B;  2CX8 A;  1UAK A;  3KY7 A;  3IC6 A;  3AI9 X;  3QUV A;  1GZ0 A;  1V2X A;  2I6D A;  3DCM X;  3L8U A;  1UAJ A;  1VHY A;  4IG6 A;  1UAL A;  1P9P A;  3N4J A;  1UAM A;  1J85 A;  2QWV A;  4E8B A;  2O3A A;  3N4K A;  4H3Z A;  3NK7 A;  3AIA A; 
#chains in the KnotProt database with same CATH topology
 1K3R A;  1NXZ A;  3GYQ A;  1VHK A;  3E5Y A;  1VH0 A;  3ONP A;  3KNU A;  3KTY A;  2YY8 A;  1O6D A;  2QMM A;  1MXI A;  4CNE B;  3AXZ A;  4CNG B;  1X7O A;  1NS5 A;  2Z0Y A;  3ILK A;  3NK6 A;  1TO0 A;  1ZJR A;  4FAK A;  4H3Y A;  2HA8 A;  3IEF A;  1V6Z A;  1X7P A;  4CNF B;  2CX8 A;  1UAK A;  3KY7 A;  3IC6 A;  3AI9 X;  3QUV A;  1GZ0 A;  1V2X A;  2I6D A;  3DCM X;  3L8U A;  1UAJ A;  1VHY A;  4IG6 A;  1UAL A;  1P9P A;  3N4J A;  1UAM A;  1J85 A;  2QWV A;  4E8B A;  2O3A A;  3N4K A;  4H3Z A;  3NK7 A;  3AIA A; 
#chains in the KnotProt database with same CATH homology
 1K3R A;  1NXZ A;  3GYQ A;  1VHK A;  3E5Y A;  1VH0 A;  3ONP A;  3KNU A;  3KTY A;  2YY8 A;  1O6D A;  2QMM A;  1MXI A;  4CNE B;  3AXZ A;  4CNG B;  1X7O A;  1NS5 A;  2Z0Y A;  3ILK A;  3NK6 A;  1TO0 A;  1ZJR A;  4FAK A;  4H3Y A;  2HA8 A;  3IEF A;  1V6Z A;  1X7P A;  4CNF B;  2CX8 A;  1UAK A;  3KY7 A;  3IC6 A;  3AI9 X;  3QUV A;  1GZ0 A;  1V2X A;  2I6D A;  3DCM X;  3L8U A;  1UAJ A;  1VHY A;  4IG6 A;  1UAL A;  1P9P A;  3N4J A;  1UAM A;  1J85 A;  2QWV A;  4E8B A;  2O3A A;  3N4K A;  4H3Z A;  3NK7 A;  3AIA A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling