1UAMA

Crystal structure of trna(m1g37)methyltransferase: insight into trna recognition
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 88-132 45 1-87, 133-252 87 120 knot
Chain Sequence
SHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQ--AEEDSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNSLEHH
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 88-133 46 1-87, 134-250 87 117 knot
view details
2.1 91-228 138 1-87, 238-250 88-90, 229-237 87 13 slipknot
sequence length 252
structure length 250
publication title Crystal structure of tRNA(m(1)G37)methyltransferase: insights into tRNA recognition
pubmed doi rcsb
molecule tags Transferase
molecule keywords tRNA (Guanine-N(1)-)-methyltransferase
source organism Haemophilus influenzae
missing residues 166-167
total genus Genus: 74
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2003-03-11
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 1uamA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1uamA01
1O6DA 1VHKA 3AXZA 2YY8A 1VH0A 4E8BA 2QWVA 1V2XA 1GZ0A 2HA8A 2CX8A 1VHYA 1X7OA 1UAKA 1UALA 3QUVA 1NS5A 4CNFB 1V6ZA 1X7PA 3GYQA 1UAMA 1K3RA 3KY7A 3ILKA 4H3ZA 3AI9X 1P9PA 3DCMX 3N4JA 2QMMA 3NK6A 1UAJA 1NXZA 1TO0A 3NK7A 3ONPA 3N4KA 2O3AA 4FAKA 4H3YA 1ZJRA 2Z0YA 1MXIA 3IEFA 1J85A 4CNGB 3E5YA 3KNUA 4CNEB 3KTYA 2I6DA 3AIAA 3L8UA 4IG6A 3IC6A
chains in the KnotProt database with same CATH superfamily
1O6DA 1VHKA 3AXZA 2YY8A 1VH0A 4E8BA 2QWVA 1V2XA 1GZ0A 2HA8A 2CX8A 1VHYA 1X7OA 1UAKA 1UALA 3QUVA 1NS5A 4CNFB 1V6ZA 1X7PA 3GYQA 1UAMA 1K3RA 3KY7A 3ILKA 4H3ZA 3AI9X 1P9PA 3DCMX 3N4JA 2QMMA 3NK6A 1UAJA 1NXZA 1TO0A 3NK7A 3ONPA 3N4KA 2O3AA 4FAKA 4H3YA 1ZJRA 2Z0YA 1MXIA 3IEFA 1J85A 4CNGB 3E5YA 3KNUA 4CNEB 3KTYA 2I6DA 3AIAA 3L8UA 4IG6A 3IC6A
chains in the KnotProt database with same CATH topology
1O6DA 1VHKA 3AXZA 2YY8A 1VH0A 4E8BA 2QWVA 1V2XA 1GZ0A 2HA8A 2CX8A 1VHYA 1X7OA 1UAKA 1UALA 3QUVA 1NS5A 4CNFB 1V6ZA 1X7PA 3GYQA 1UAMA 1K3RA 3KY7A 3ILKA 4H3ZA 3AI9X 1P9PA 3DCMX 3N4JA 2QMMA 3NK6A 1UAJA 1NXZA 1TO0A 3NK7A 3ONPA 3N4KA 2O3AA 4FAKA 4H3YA 1ZJRA 2Z0YA 1MXIA 3IEFA 1J85A 4CNGB 3E5YA 3KNUA 4CNEB 3KTYA 2I6DA 3AIAA 3L8UA 4IG6A 3IC6A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1O6D A;  1VHK A;  3AXZ A;  2YY8 A;  1VH0 A;  4E8B A;  2QWV A;  1V2X A;  1GZ0 A;  2HA8 A;  2CX8 A;  1VHY A;  1X7O A;  1UAK A;  1UAL A;  3QUV A;  1NS5 A;  4CNF B;  1V6Z A;  1X7P A;  3GYQ A;  1UAM A;  1K3R A;  3KY7 A;  3ILK A;  4H3Z A;  3AI9 X;  1P9P A;  3DCM X;  3N4J A;  2QMM A;  3NK6 A;  1UAJ A;  1NXZ A;  1TO0 A;  3NK7 A;  3ONP A;  3N4K A;  2O3A A;  4FAK A;  4H3Y A;  1ZJR A;  2Z0Y A;  1MXI A;  3IEF A;  1J85 A;  4CNG B;  3E5Y A;  3KNU A;  4CNE B;  3KTY A;  2I6D A;  3AIA A;  3L8U A;  4IG6 A;  3IC6 A; 
#chains in the KnotProt database with same CATH topology
 1O6D A;  1VHK A;  3AXZ A;  2YY8 A;  1VH0 A;  4E8B A;  2QWV A;  1V2X A;  1GZ0 A;  2HA8 A;  2CX8 A;  1VHY A;  1X7O A;  1UAK A;  1UAL A;  3QUV A;  1NS5 A;  4CNF B;  1V6Z A;  1X7P A;  3GYQ A;  1UAM A;  1K3R A;  3KY7 A;  3ILK A;  4H3Z A;  3AI9 X;  1P9P A;  3DCM X;  3N4J A;  2QMM A;  3NK6 A;  1UAJ A;  1NXZ A;  1TO0 A;  3NK7 A;  3ONP A;  3N4K A;  2O3A A;  4FAK A;  4H3Y A;  1ZJR A;  2Z0Y A;  1MXI A;  3IEF A;  1J85 A;  4CNG B;  3E5Y A;  3KNU A;  4CNE B;  3KTY A;  2I6D A;  3AIA A;  3L8U A;  4IG6 A;  3IC6 A; 
#chains in the KnotProt database with same CATH homology
 1O6D A;  1VHK A;  3AXZ A;  2YY8 A;  1VH0 A;  4E8B A;  2QWV A;  1V2X A;  1GZ0 A;  2HA8 A;  2CX8 A;  1VHY A;  1X7O A;  1UAK A;  1UAL A;  3QUV A;  1NS5 A;  4CNF B;  1V6Z A;  1X7P A;  3GYQ A;  1UAM A;  1K3R A;  3KY7 A;  3ILK A;  4H3Z A;  3AI9 X;  1P9P A;  3DCM X;  3N4J A;  2QMM A;  3NK6 A;  1UAJ A;  1NXZ A;  1TO0 A;  3NK7 A;  3ONP A;  3N4K A;  2O3A A;  4FAK A;  4H3Y A;  1ZJR A;  2Z0Y A;  1MXI A;  3IEF A;  1J85 A;  4CNG B;  3E5Y A;  3KNU A;  4CNE B;  3KTY A;  2I6D A;  3AIA A;  3L8U A;  4IG6 A;  3IC6 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling