1UALA

Crystal structure of trna(m1g37)methyltransferase: insight into trna recognition
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 88-132 45 1-87, 133-252 87 120 knot
Chain Sequence
SHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVL---------SFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNSLEHH
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 88-133 46 1-87, 134-243 87 110 knot
view details
2.1 86-130 45 1-85 137-243 131-136 85 107 slipknot
sequence length 252
structure length 243
publication title Crystal structure of tRNA(m(1)G37)methyltransferase: insights into tRNA recognition
pubmed doi rcsb
molecule tags Transferase
molecule keywords tRNA (Guanine-N(1)-)-methyltransferase
source organism Haemophilus influenzae
missing residues 163-171
total genus Genus: 70
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2003-03-11
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 1ualA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1ualA01
3NK7A 1J85A 4FAKA 3KNUA 4CNFB 1TO0A 2HA8A 1K3RA 2QWVA 1VH0A 2CX8A 3L8UA 4CNEB 1UAKA 1UAMA 2O3AA 2I6DA 3E5YA 1V2XA 2YY8A 3N4KA 3AXZA 4H3YA 4IG6A 1X7PA 3NK6A 4H3ZA 1V6ZA 1UALA 1X7OA 3IC6A 3ONPA 2QMMA 3QUVA 3GYQA 1NS5A 3KY7A 1O6DA 4E8BA 1GZ0A 3IEFA 1ZJRA 1P9PA 1UAJA 3DCMX 2Z0YA 3KTYA 1VHYA 3N4JA 3AI9X 3ILKA 4CNGB 1VHKA 1MXIA 1NXZA 3AIAA
chains in the KnotProt database with same CATH superfamily
3NK7A 1J85A 4FAKA 3KNUA 4CNFB 1TO0A 2HA8A 1K3RA 2QWVA 1VH0A 2CX8A 3L8UA 4CNEB 1UAKA 1UAMA 2O3AA 2I6DA 3E5YA 1V2XA 2YY8A 3N4KA 3AXZA 4H3YA 4IG6A 1X7PA 3NK6A 4H3ZA 1V6ZA 1UALA 1X7OA 3IC6A 3ONPA 2QMMA 3QUVA 3GYQA 1NS5A 3KY7A 1O6DA 4E8BA 1GZ0A 3IEFA 1ZJRA 1P9PA 1UAJA 3DCMX 2Z0YA 3KTYA 1VHYA 3N4JA 3AI9X 3ILKA 4CNGB 1VHKA 1MXIA 1NXZA 3AIAA
chains in the KnotProt database with same CATH topology
3NK7A 1J85A 4FAKA 3KNUA 4CNFB 1TO0A 2HA8A 1K3RA 2QWVA 1VH0A 2CX8A 3L8UA 4CNEB 1UAKA 1UAMA 2O3AA 2I6DA 3E5YA 1V2XA 2YY8A 3N4KA 3AXZA 4H3YA 4IG6A 1X7PA 3NK6A 4H3ZA 1V6ZA 1UALA 1X7OA 3IC6A 3ONPA 2QMMA 3QUVA 3GYQA 1NS5A 3KY7A 1O6DA 4E8BA 1GZ0A 3IEFA 1ZJRA 1P9PA 1UAJA 3DCMX 2Z0YA 3KTYA 1VHYA 3N4JA 3AI9X 3ILKA 4CNGB 1VHKA 1MXIA 1NXZA 3AIAA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3NK7 A;  1J85 A;  4FAK A;  3KNU A;  4CNF B;  1TO0 A;  2HA8 A;  1K3R A;  2QWV A;  1VH0 A;  2CX8 A;  3L8U A;  4CNE B;  1UAK A;  1UAM A;  2O3A A;  2I6D A;  3E5Y A;  1V2X A;  2YY8 A;  3N4K A;  3AXZ A;  4H3Y A;  4IG6 A;  1X7P A;  3NK6 A;  4H3Z A;  1V6Z A;  1UAL A;  1X7O A;  3IC6 A;  3ONP A;  2QMM A;  3QUV A;  3GYQ A;  1NS5 A;  3KY7 A;  1O6D A;  4E8B A;  1GZ0 A;  3IEF A;  1ZJR A;  1P9P A;  1UAJ A;  3DCM X;  2Z0Y A;  3KTY A;  1VHY A;  3N4J A;  3AI9 X;  3ILK A;  4CNG B;  1VHK A;  1MXI A;  1NXZ A;  3AIA A; 
#chains in the KnotProt database with same CATH topology
 3NK7 A;  1J85 A;  4FAK A;  3KNU A;  4CNF B;  1TO0 A;  2HA8 A;  1K3R A;  2QWV A;  1VH0 A;  2CX8 A;  3L8U A;  4CNE B;  1UAK A;  1UAM A;  2O3A A;  2I6D A;  3E5Y A;  1V2X A;  2YY8 A;  3N4K A;  3AXZ A;  4H3Y A;  4IG6 A;  1X7P A;  3NK6 A;  4H3Z A;  1V6Z A;  1UAL A;  1X7O A;  3IC6 A;  3ONP A;  2QMM A;  3QUV A;  3GYQ A;  1NS5 A;  3KY7 A;  1O6D A;  4E8B A;  1GZ0 A;  3IEF A;  1ZJR A;  1P9P A;  1UAJ A;  3DCM X;  2Z0Y A;  3KTY A;  1VHY A;  3N4J A;  3AI9 X;  3ILK A;  4CNG B;  1VHK A;  1MXI A;  1NXZ A;  3AIA A; 
#chains in the KnotProt database with same CATH homology
 3NK7 A;  1J85 A;  4FAK A;  3KNU A;  4CNF B;  1TO0 A;  2HA8 A;  1K3R A;  2QWV A;  1VH0 A;  2CX8 A;  3L8U A;  4CNE B;  1UAK A;  1UAM A;  2O3A A;  2I6D A;  3E5Y A;  1V2X A;  2YY8 A;  3N4K A;  3AXZ A;  4H3Y A;  4IG6 A;  1X7P A;  3NK6 A;  4H3Z A;  1V6Z A;  1UAL A;  1X7O A;  3IC6 A;  3ONP A;  2QMM A;  3QUV A;  3GYQ A;  1NS5 A;  3KY7 A;  1O6D A;  4E8B A;  1GZ0 A;  3IEF A;  1ZJR A;  1P9P A;  1UAJ A;  3DCM X;  2Z0Y A;  3KTY A;  1VHY A;  3N4J A;  3AI9 X;  3ILK A;  4CNG B;  1VHK A;  1MXI A;  1NXZ A;  3AIA A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling