3IEFA

Crystal structure of trna guanine-n1-methyltransferase from bartonella henselae using mpcs.
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 84-127 44 1-83, 128-229 83 102 knot
Chain Sequence
KFQARVLTLYPEMFPGFLGCSLAGQALKQGIWSLETVQIRDFA-----SVDDTPAGGGAGMVMRADVLAAALDSCPNDSPRLLMSPRGRLLNQAYARSLARSSGVTLVCGRFEGVDERIIEARELEEVSIGDYILSGGETAALVLLDAIVRLLPGVMGNEISAKCESFENGLLEHPQYTRPAVFEGRGIPPVLTSGHHKAIANWRQQQAESLTRQRRPDLYALYNKNRQ
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 78-123 46 1-77, 124-224 77 101 knot
sequence length 229
structure length 224
publication title Crystal structure of tRNA guanine-n1-methyltransferase from Bartonella henselae using MPCS.
rcsb
molecule tags Transferase, rna binding protein
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
source organism Bartonella henselae
missing residues 44-48
total genus Genus: 63
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-07-22
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 3iefA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3iefA01
1V2XA 4FAKA 1P9PA 3NK6A 2I6DA 4H3YA 4CNFB 3IC6A 2CX8A 1J85A 1MXIA 1X7PA 3AI9X 3QUVA 3AXZA 1O6DA 1VHYA 1K3RA 3ONPA 4E8BA 2O3AA 2QWVA 3KY7A 1X7OA 1UALA 1UAKA 1VHKA 2Z0YA 3ILKA 1NXZA 3KTYA 4CNEB 3N4KA 4IG6A 3IEFA 2HA8A 2QMMA 2YY8A 1IPAA 1TO0A 4CNGB 3E5YA 1V6ZA 1UAJA 3AIAA 3KNUA 1NS5A 3GYQA 3DCMX 3N4JA 3NK7A 1GZ0A 4H3ZA 1VH0A 1UAMA 3L8UA 1ZJRA
chains in the KnotProt database with same CATH superfamily
1V2XA 4FAKA 1P9PA 3NK6A 2I6DA 4H3YA 4CNFB 3IC6A 2CX8A 1J85A 1MXIA 1X7PA 3AI9X 3QUVA 3AXZA 1O6DA 1VHYA 1K3RA 3ONPA 4E8BA 2O3AA 2QWVA 3KY7A 1X7OA 1UALA 1UAKA 1VHKA 2Z0YA 3ILKA 1NXZA 3KTYA 4CNEB 3N4KA 4IG6A 3IEFA 2HA8A 2QMMA 2YY8A 1IPAA 1TO0A 4CNGB 3E5YA 1V6ZA 1UAJA 3AIAA 3KNUA 1NS5A 3GYQA 3DCMX 3N4JA 3NK7A 1GZ0A 4H3ZA 1VH0A 1UAMA 3L8UA 1ZJRA
chains in the KnotProt database with same CATH topology
1V2XA 4FAKA 1P9PA 3NK6A 2I6DA 4H3YA 4CNFB 3IC6A 2CX8A 1J85A 1MXIA 1X7PA 3AI9X 3QUVA 3AXZA 1O6DA 1VHYA 1K3RA 3ONPA 4E8BA 2O3AA 2QWVA 3KY7A 1X7OA 1UALA 1UAKA 1VHKA 2Z0YA 3ILKA 1NXZA 3KTYA 4CNEB 3N4KA 4IG6A 3IEFA 2HA8A 2QMMA 2YY8A 1IPAA 1TO0A 4CNGB 3E5YA 1V6ZA 1UAJA 3AIAA 3KNUA 1NS5A 3GYQA 3DCMX 3N4JA 3NK7A 1GZ0A 4H3ZA 1VH0A 1UAMA 3L8UA 1ZJRA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1V2X A;  4FAK A;  1P9P A;  3NK6 A;  2I6D A;  4H3Y A;  4CNF B;  3IC6 A;  2CX8 A;  1J85 A;  1MXI A;  1X7P A;  3AI9 X;  3QUV A;  3AXZ A;  1O6D A;  1VHY A;  1K3R A;  3ONP A;  4E8B A;  2O3A A;  2QWV A;  3KY7 A;  1X7O A;  1UAL A;  1UAK A;  1VHK A;  2Z0Y A;  3ILK A;  1NXZ A;  3KTY A;  4CNE B;  3N4K A;  4IG6 A;  3IEF A;  2HA8 A;  2QMM A;  2YY8 A;  1IPA A;  1TO0 A;  4CNG B;  3E5Y A;  1V6Z A;  1UAJ A;  3AIA A;  3KNU A;  1NS5 A;  3GYQ A;  3DCM X;  3N4J A;  3NK7 A;  1GZ0 A;  4H3Z A;  1VH0 A;  1UAM A;  3L8U A;  1ZJR A; 
#chains in the KnotProt database with same CATH topology
 1V2X A;  4FAK A;  1P9P A;  3NK6 A;  2I6D A;  4H3Y A;  4CNF B;  3IC6 A;  2CX8 A;  1J85 A;  1MXI A;  1X7P A;  3AI9 X;  3QUV A;  3AXZ A;  1O6D A;  1VHY A;  1K3R A;  3ONP A;  4E8B A;  2O3A A;  2QWV A;  3KY7 A;  1X7O A;  1UAL A;  1UAK A;  1VHK A;  2Z0Y A;  3ILK A;  1NXZ A;  3KTY A;  4CNE B;  3N4K A;  4IG6 A;  3IEF A;  2HA8 A;  2QMM A;  2YY8 A;  1IPA A;  1TO0 A;  4CNG B;  3E5Y A;  1V6Z A;  1UAJ A;  3AIA A;  3KNU A;  1NS5 A;  3GYQ A;  3DCM X;  3N4J A;  3NK7 A;  1GZ0 A;  4H3Z A;  1VH0 A;  1UAM A;  3L8U A;  1ZJR A; 
#chains in the KnotProt database with same CATH homology
 1V2X A;  4FAK A;  1P9P A;  3NK6 A;  2I6D A;  4H3Y A;  4CNF B;  3IC6 A;  2CX8 A;  1J85 A;  1MXI A;  1X7P A;  3AI9 X;  3QUV A;  3AXZ A;  1O6D A;  1VHY A;  1K3R A;  3ONP A;  4E8B A;  2O3A A;  2QWV A;  3KY7 A;  1X7O A;  1UAL A;  1UAK A;  1VHK A;  2Z0Y A;  3ILK A;  1NXZ A;  3KTY A;  4CNE B;  3N4K A;  4IG6 A;  3IEF A;  2HA8 A;  2QMM A;  2YY8 A;  1IPA A;  1TO0 A;  4CNG B;  3E5Y A;  1V6Z A;  1UAJ A;  3AIA A;  3KNU A;  1NS5 A;  3GYQ A;  3DCM X;  3N4J A;  3NK7 A;  1GZ0 A;  4H3Z A;  1VH0 A;  1UAM A;  3L8U A;  1ZJR A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling