3IEFA

Crystal structure of trna guanine-n1-methyltransferase from bartonella henselae using mpcs.
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 84-127 44 1-83, 128-229 83 102 knot
Chain Sequence
KFQARVLTLYPEMFPGFLGCSLAGQALKQGIWSLETVQIRDFA-----SVDDTPAGGGAGMVMRADVLAAALDSCPNDSPRLLMSPRGRLLNQAYARSLARSSGVTLVCGRFEGVDERIIEARELEEVSIGDYILSGGETAALVLLDAIVRLLPGVMGNEISAKCESFENGLLEHPQYTRPAVFEGRGIPPVLTSGHHKAIANWRQQQAESLTRQRRPDLYALYNKNRQ
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 78-123 46 1-77, 124-224 77 101 knot
sequence length 229
structure length 224
publication title Crystal structure of tRNA guanine-n1-methyltransferase from Bartonella henselae using MPCS.
rcsb
molecule tags Transferase, rna binding protein
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
source organism Bartonella henselae
missing residues 44-48
total genus Genus: 63
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-07-22
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 3iefA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3iefA01
4CNFB 1UAMA 1TO0A 4FAKA 4CNGB 3NK7A 2QWVA 3IC6A 3NK6A 1X7PA 1V6ZA 3KTYA 3AXZA 1GZ0A 3IEFA 3KY7A 1VH0A 3E5YA 3KNUA 4CNEB 1ZJRA 1UALA 1NXZA 4H3ZA 2YY8A 2CX8A 1O6DA 3GYQA 3ONPA 3N4JA 1UAKA 2I6DA 1UAJA 3N4KA 2HA8A 1P9PA 2QMMA 1VHKA 1J85A 1V2XA 3AIAA 1NS5A 1K3RA 3AI9X 1VHYA 4E8BA 4H3YA 3QUVA 4IG6A 3ILKA 3DCMX 3L8UA 2Z0YA 2O3AA 1X7OA 1MXIA
chains in the KnotProt database with same CATH superfamily
4CNFB 1UAMA 1TO0A 4FAKA 4CNGB 3NK7A 2QWVA 3IC6A 3NK6A 1X7PA 1V6ZA 3KTYA 3AXZA 1GZ0A 3IEFA 3KY7A 1VH0A 3E5YA 3KNUA 4CNEB 1ZJRA 1UALA 1NXZA 4H3ZA 2YY8A 2CX8A 1O6DA 3GYQA 3ONPA 3N4JA 1UAKA 2I6DA 1UAJA 3N4KA 2HA8A 1P9PA 2QMMA 1VHKA 1J85A 1V2XA 3AIAA 1NS5A 1K3RA 3AI9X 1VHYA 4E8BA 4H3YA 3QUVA 4IG6A 3ILKA 3DCMX 3L8UA 2Z0YA 2O3AA 1X7OA 1MXIA
chains in the KnotProt database with same CATH topology
4CNFB 1UAMA 1TO0A 4FAKA 4CNGB 3NK7A 2QWVA 3IC6A 3NK6A 1X7PA 1V6ZA 3KTYA 3AXZA 1GZ0A 3IEFA 3KY7A 1VH0A 3E5YA 3KNUA 4CNEB 1ZJRA 1UALA 1NXZA 4H3ZA 2YY8A 2CX8A 1O6DA 3GYQA 3ONPA 3N4JA 1UAKA 2I6DA 1UAJA 3N4KA 2HA8A 1P9PA 2QMMA 1VHKA 1J85A 1V2XA 3AIAA 1NS5A 1K3RA 3AI9X 1VHYA 4E8BA 4H3YA 3QUVA 4IG6A 3ILKA 3DCMX 3L8UA 2Z0YA 2O3AA 1X7OA 1MXIA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 4CNF B;  1UAM A;  1TO0 A;  4FAK A;  4CNG B;  3NK7 A;  2QWV A;  3IC6 A;  3NK6 A;  1X7P A;  1V6Z A;  3KTY A;  3AXZ A;  1GZ0 A;  3IEF A;  3KY7 A;  1VH0 A;  3E5Y A;  3KNU A;  4CNE B;  1ZJR A;  1UAL A;  1NXZ A;  4H3Z A;  2YY8 A;  2CX8 A;  1O6D A;  3GYQ A;  3ONP A;  3N4J A;  1UAK A;  2I6D A;  1UAJ A;  3N4K A;  2HA8 A;  1P9P A;  2QMM A;  1VHK A;  1J85 A;  1V2X A;  3AIA A;  1NS5 A;  1K3R A;  3AI9 X;  1VHY A;  4E8B A;  4H3Y A;  3QUV A;  4IG6 A;  3ILK A;  3DCM X;  3L8U A;  2Z0Y A;  2O3A A;  1X7O A;  1MXI A; 
#chains in the KnotProt database with same CATH topology
 4CNF B;  1UAM A;  1TO0 A;  4FAK A;  4CNG B;  3NK7 A;  2QWV A;  3IC6 A;  3NK6 A;  1X7P A;  1V6Z A;  3KTY A;  3AXZ A;  1GZ0 A;  3IEF A;  3KY7 A;  1VH0 A;  3E5Y A;  3KNU A;  4CNE B;  1ZJR A;  1UAL A;  1NXZ A;  4H3Z A;  2YY8 A;  2CX8 A;  1O6D A;  3GYQ A;  3ONP A;  3N4J A;  1UAK A;  2I6D A;  1UAJ A;  3N4K A;  2HA8 A;  1P9P A;  2QMM A;  1VHK A;  1J85 A;  1V2X A;  3AIA A;  1NS5 A;  1K3R A;  3AI9 X;  1VHY A;  4E8B A;  4H3Y A;  3QUV A;  4IG6 A;  3ILK A;  3DCM X;  3L8U A;  2Z0Y A;  2O3A A;  1X7O A;  1MXI A; 
#chains in the KnotProt database with same CATH homology
 4CNF B;  1UAM A;  1TO0 A;  4FAK A;  4CNG B;  3NK7 A;  2QWV A;  3IC6 A;  3NK6 A;  1X7P A;  1V6Z A;  3KTY A;  3AXZ A;  1GZ0 A;  3IEF A;  3KY7 A;  1VH0 A;  3E5Y A;  3KNU A;  4CNE B;  1ZJR A;  1UAL A;  1NXZ A;  4H3Z A;  2YY8 A;  2CX8 A;  1O6D A;  3GYQ A;  3ONP A;  3N4J A;  1UAK A;  2I6D A;  1UAJ A;  3N4K A;  2HA8 A;  1P9P A;  2QMM A;  1VHK A;  1J85 A;  1V2X A;  3AIA A;  1NS5 A;  1K3R A;  3AI9 X;  1VHY A;  4E8B A;  4H3Y A;  3QUV A;  4IG6 A;  3ILK A;  3DCM X;  3L8U A;  2Z0Y A;  2O3A A;  1X7O A;  1MXI A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling