3ONPA

Crystal structure of trna/rrna methyltransferase spou from rhodobacter sphaeroides
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 76-130 55 1-75, 131-159 75 29 knot
Chain Sequence
IEPVFILVRPQMGENIGAAARAMLNFGLGRLRIVDPRDGWPNPKAVAMASGAGRLLDHAGLFPTVAEAIRDCDYVFATTARGRELTKPVMTPERAMAHGRALTGEGRRVGILFGPERTGLENEDVALANAIVTVPVNPEFFSLNLAQCVLLLAYEWRRQ
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 77-133 57 1-76, 134-159 76 26 knot
view details
2.1 57-129 73 1-56 135-159 130-134 56 25 slipknot
view details
3.1 75-131 57 1-74 149-159 132-148 74 11 slipknot
sequence length 159
structure length 159
publication title Crystal Structure of tRNA/rRNA Methyltransferase SpoU from Rhodobacter sphaeroides
rcsb
molecule tags Transferase
molecule keywords tRNA/rRNA methyltransferase (SpoU)
source organism Rhodobacter sphaeroides
total genus Genus: 49
ec nomenclature
pdb deposition date 2010-08-30
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3onpA00
1O6DA 1VHKA 2YY8A 3AXZA 1VH0A 4E8BA 2QWVA 1V2XA 1GZ0A 2HA8A 2CX8A 1VHYA 1X7OA 1UAKA 1NS5A 1UALA 3QUVA 4CNFB 1V6ZA 1X7PA 3GYQA 1K3RA 1UAMA 3ILKA 3KY7A 4H3ZA 3AI9X 1P9PA 3DCMX 3N4JA 2QMMA 3NK6A 1UAJA 1NXZA 1TO0A 3NK7A 3ONPA 3N4KA 2O3AA 4FAKA 4H3YA 1ZJRA 2Z0YA 1MXIA 3IEFA 1J85A 4CNGB 3E5YA 3KNUA 4CNEB 3KTYA 2I6DA 3AIAA 3L8UA 4IG6A 3IC6A
chains in the KnotProt database with same CATH superfamily
1O6DA 1VHKA 2YY8A 3AXZA 1VH0A 4E8BA 2QWVA 1V2XA 1GZ0A 2HA8A 2CX8A 1VHYA 1X7OA 1UAKA 1NS5A 1UALA 3QUVA 4CNFB 1V6ZA 1X7PA 3GYQA 1K3RA 1UAMA 3ILKA 3KY7A 4H3ZA 3AI9X 1P9PA 3DCMX 3N4JA 2QMMA 3NK6A 1UAJA 1NXZA 1TO0A 3NK7A 3ONPA 3N4KA 2O3AA 4FAKA 4H3YA 1ZJRA 2Z0YA 1MXIA 3IEFA 1J85A 4CNGB 3E5YA 3KNUA 4CNEB 3KTYA 2I6DA 3AIAA 3L8UA 4IG6A 3IC6A
chains in the KnotProt database with same CATH topology
1O6DA 1VHKA 2YY8A 3AXZA 1VH0A 4E8BA 2QWVA 1V2XA 1GZ0A 2HA8A 2CX8A 1VHYA 1X7OA 1UAKA 1NS5A 1UALA 3QUVA 4CNFB 1V6ZA 1X7PA 3GYQA 1K3RA 1UAMA 3ILKA 3KY7A 4H3ZA 3AI9X 1P9PA 3DCMX 3N4JA 2QMMA 3NK6A 1UAJA 1NXZA 1TO0A 3NK7A 3ONPA 3N4KA 2O3AA 4FAKA 4H3YA 1ZJRA 2Z0YA 1MXIA 3IEFA 1J85A 4CNGB 3E5YA 3KNUA 4CNEB 3KTYA 2I6DA 3AIAA 3L8UA 4IG6A 3IC6A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1O6D A;  1VHK A;  2YY8 A;  3AXZ A;  1VH0 A;  4E8B A;  2QWV A;  1V2X A;  1GZ0 A;  2HA8 A;  2CX8 A;  1VHY A;  1X7O A;  1UAK A;  1NS5 A;  1UAL A;  3QUV A;  4CNF B;  1V6Z A;  1X7P A;  3GYQ A;  1K3R A;  1UAM A;  3ILK A;  3KY7 A;  4H3Z A;  3AI9 X;  1P9P A;  3DCM X;  3N4J A;  2QMM A;  3NK6 A;  1UAJ A;  1NXZ A;  1TO0 A;  3NK7 A;  3ONP A;  3N4K A;  2O3A A;  4FAK A;  4H3Y A;  1ZJR A;  2Z0Y A;  1MXI A;  3IEF A;  1J85 A;  4CNG B;  3E5Y A;  3KNU A;  4CNE B;  3KTY A;  2I6D A;  3AIA A;  3L8U A;  4IG6 A;  3IC6 A; 
#chains in the KnotProt database with same CATH topology
 1O6D A;  1VHK A;  2YY8 A;  3AXZ A;  1VH0 A;  4E8B A;  2QWV A;  1V2X A;  1GZ0 A;  2HA8 A;  2CX8 A;  1VHY A;  1X7O A;  1UAK A;  1NS5 A;  1UAL A;  3QUV A;  4CNF B;  1V6Z A;  1X7P A;  3GYQ A;  1K3R A;  1UAM A;  3ILK A;  3KY7 A;  4H3Z A;  3AI9 X;  1P9P A;  3DCM X;  3N4J A;  2QMM A;  3NK6 A;  1UAJ A;  1NXZ A;  1TO0 A;  3NK7 A;  3ONP A;  3N4K A;  2O3A A;  4FAK A;  4H3Y A;  1ZJR A;  2Z0Y A;  1MXI A;  3IEF A;  1J85 A;  4CNG B;  3E5Y A;  3KNU A;  4CNE B;  3KTY A;  2I6D A;  3AIA A;  3L8U A;  4IG6 A;  3IC6 A; 
#chains in the KnotProt database with same CATH homology
 1O6D A;  1VHK A;  2YY8 A;  3AXZ A;  1VH0 A;  4E8B A;  2QWV A;  1V2X A;  1GZ0 A;  2HA8 A;  2CX8 A;  1VHY A;  1X7O A;  1UAK A;  1NS5 A;  1UAL A;  3QUV A;  4CNF B;  1V6Z A;  1X7P A;  3GYQ A;  1K3R A;  1UAM A;  3ILK A;  3KY7 A;  4H3Z A;  3AI9 X;  1P9P A;  3DCM X;  3N4J A;  2QMM A;  3NK6 A;  1UAJ A;  1NXZ A;  1TO0 A;  3NK7 A;  3ONP A;  3N4K A;  2O3A A;  4FAK A;  4H3Y A;  1ZJR A;  2Z0Y A;  1MXI A;  3IEF A;  1J85 A;  4CNG B;  3E5Y A;  3KNU A;  4CNE B;  3KTY A;  2I6D A;  3AIA A;  3L8U A;  4IG6 A;  3IC6 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling