3ONPA

Crystal structure of trna/rrna methyltransferase spou from rhodobacter sphaeroides
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 76-130 55 1-75, 131-159 75 29 knot
Chain Sequence
IEPVFILVRPQMGENIGAAARAMLNFGLGRLRIVDPRDGWPNPKAVAMASGAGRLLDHAGLFPTVAEAIRDCDYVFATTARGRELTKPVMTPERAMAHGRALTGEGRRVGILFGPERTGLENEDVALANAIVTVPVNPEFFSLNLAQCVLLLAYEWRRQ
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 77-133 57 1-76, 134-159 76 26 knot
view details
2.1 57-129 73 1-56 135-159 130-134 56 25 slipknot
view details
3.1 75-131 57 1-74 149-159 132-148 74 11 slipknot
sequence length 159
structure length 159
publication title Crystal Structure of tRNA/rRNA Methyltransferase SpoU from Rhodobacter sphaeroides
rcsb
molecule tags Transferase
molecule keywords tRNA/rRNA methyltransferase (SpoU)
source organism Rhodobacter sphaeroides
total genus Genus: 49
ec nomenclature
pdb deposition date 2010-08-30
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3onpA00
2CX8A 3QUVA 2O3AA 3AXZA 3IC6A 1O6DA 2I6DA 1V2XA 1VH0A 3AIAA 3NK6A 1UAMA 3E5YA 1UALA 1IPAA 1X7OA 3ILKA 1V6ZA 4H3ZA 1VHKA 1UAJA 1VHYA 4CNFB 1P9PA 2Z0YA 3GYQA 3AI9X 3IEFA 4CNGB 1K3RA 3DCMX 3KTYA 4CNEB 1X7PA 2YY8A 1ZJRA 2QMMA 3L8UA 1NS5A 4IG6A 1MXIA 1GZ0A 3ONPA 3KNUA 3N4KA 3NK7A 4E8BA 1NXZA 3KY7A 2QWVA 1TO0A 4H3YA 2HA8A 4FAKA 1UAKA 1J85A 3N4JA
chains in the KnotProt database with same CATH superfamily
2CX8A 3QUVA 2O3AA 3AXZA 3IC6A 1O6DA 2I6DA 1V2XA 1VH0A 3AIAA 3NK6A 1UAMA 3E5YA 1UALA 1IPAA 1X7OA 3ILKA 1V6ZA 4H3ZA 1VHKA 1UAJA 1VHYA 4CNFB 1P9PA 2Z0YA 3GYQA 3AI9X 3IEFA 4CNGB 1K3RA 3DCMX 3KTYA 4CNEB 1X7PA 2YY8A 1ZJRA 2QMMA 3L8UA 1NS5A 4IG6A 1MXIA 1GZ0A 3ONPA 3KNUA 3N4KA 3NK7A 4E8BA 1NXZA 3KY7A 2QWVA 1TO0A 4H3YA 2HA8A 4FAKA 1UAKA 1J85A 3N4JA
chains in the KnotProt database with same CATH topology
2CX8A 3QUVA 2O3AA 3AXZA 3IC6A 1O6DA 2I6DA 1V2XA 1VH0A 3AIAA 3NK6A 1UAMA 3E5YA 1UALA 1IPAA 1X7OA 3ILKA 1V6ZA 4H3ZA 1VHKA 1UAJA 1VHYA 4CNFB 1P9PA 2Z0YA 3GYQA 3AI9X 3IEFA 4CNGB 1K3RA 3DCMX 3KTYA 4CNEB 1X7PA 2YY8A 1ZJRA 2QMMA 3L8UA 1NS5A 4IG6A 1MXIA 1GZ0A 3ONPA 3KNUA 3N4KA 3NK7A 4E8BA 1NXZA 3KY7A 2QWVA 1TO0A 4H3YA 2HA8A 4FAKA 1UAKA 1J85A 3N4JA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2CX8 A;  3QUV A;  2O3A A;  3AXZ A;  3IC6 A;  1O6D A;  2I6D A;  1V2X A;  1VH0 A;  3AIA A;  3NK6 A;  1UAM A;  3E5Y A;  1UAL A;  1IPA A;  1X7O A;  3ILK A;  1V6Z A;  4H3Z A;  1VHK A;  1UAJ A;  1VHY A;  4CNF B;  1P9P A;  2Z0Y A;  3GYQ A;  3AI9 X;  3IEF A;  4CNG B;  1K3R A;  3DCM X;  3KTY A;  4CNE B;  1X7P A;  2YY8 A;  1ZJR A;  2QMM A;  3L8U A;  1NS5 A;  4IG6 A;  1MXI A;  1GZ0 A;  3ONP A;  3KNU A;  3N4K A;  3NK7 A;  4E8B A;  1NXZ A;  3KY7 A;  2QWV A;  1TO0 A;  4H3Y A;  2HA8 A;  4FAK A;  1UAK A;  1J85 A;  3N4J A; 
#chains in the KnotProt database with same CATH topology
 2CX8 A;  3QUV A;  2O3A A;  3AXZ A;  3IC6 A;  1O6D A;  2I6D A;  1V2X A;  1VH0 A;  3AIA A;  3NK6 A;  1UAM A;  3E5Y A;  1UAL A;  1IPA A;  1X7O A;  3ILK A;  1V6Z A;  4H3Z A;  1VHK A;  1UAJ A;  1VHY A;  4CNF B;  1P9P A;  2Z0Y A;  3GYQ A;  3AI9 X;  3IEF A;  4CNG B;  1K3R A;  3DCM X;  3KTY A;  4CNE B;  1X7P A;  2YY8 A;  1ZJR A;  2QMM A;  3L8U A;  1NS5 A;  4IG6 A;  1MXI A;  1GZ0 A;  3ONP A;  3KNU A;  3N4K A;  3NK7 A;  4E8B A;  1NXZ A;  3KY7 A;  2QWV A;  1TO0 A;  4H3Y A;  2HA8 A;  4FAK A;  1UAK A;  1J85 A;  3N4J A; 
#chains in the KnotProt database with same CATH homology
 2CX8 A;  3QUV A;  2O3A A;  3AXZ A;  3IC6 A;  1O6D A;  2I6D A;  1V2X A;  1VH0 A;  3AIA A;  3NK6 A;  1UAM A;  3E5Y A;  1UAL A;  1IPA A;  1X7O A;  3ILK A;  1V6Z A;  4H3Z A;  1VHK A;  1UAJ A;  1VHY A;  4CNF B;  1P9P A;  2Z0Y A;  3GYQ A;  3AI9 X;  3IEF A;  4CNG B;  1K3R A;  3DCM X;  3KTY A;  4CNE B;  1X7P A;  2YY8 A;  1ZJR A;  2QMM A;  3L8U A;  1NS5 A;  4IG6 A;  1MXI A;  1GZ0 A;  3ONP A;  3KNU A;  3N4K A;  3NK7 A;  4E8B A;  1NXZ A;  3KY7 A;  2QWV A;  1TO0 A;  4H3Y A;  2HA8 A;  4FAK A;  1UAK A;  1J85 A;  3N4J A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling