3ILKA

The structure of a probable methylase family protein from haemophilus influenzae rd kw20
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 80-130 51 1-79, 131-240 79 110 knot
Chain Sequence
NAMLENIRIVLIETSHSGNIGSAARAMKTMGLTQLCLVSPKSVDEQSYALSAGAENIVKNARVVDSFDEAVDDCSLVIGTSARLRHLQNTLIEPRECAEKVVAYKGKIAIVFGRERIGLTNEELLKCHYHLNIPANPDYSSLNLAMAVQLVSYELRMAFLVQNNKKNSLSL-EKNYPTTDQLAYFFDYTERIYQSLGFIQNQGVMRKLKRLYYRAKLEKNELNILNGMLSAVEKRIDLTK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 79-131 53 1-78, 132-239 78 108 knot
view details
2.1 81-165 85 1-78, 183-239 79-80, 166-182 78 57 slipknot
view details
2.1 81-182 102 1-78, 206-239 79-80, 183-205 78 34 slipknot
sequence length 240
structure length 239
publication title The structure of a probable methylase family protein from Haemophilus influenzae Rd KW20
rcsb
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized tRNA/rRNA methyltransferase HI0380
source organism Haemophilus influenzae
missing residues 172
total genus Genus: 73
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-08-07
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3ilkA01
1K3RA 1NXZA 3GYQA 1VHKA 3E5YA 1VH0A 3ONPA 3KNUA 3KTYA 2YY8A 1O6DA 2QMMA 1MXIA 4CNEB 3AXZA 4CNGB 1X7OA 1NS5A 2Z0YA 3ILKA 3NK6A 1TO0A 1ZJRA 4FAKA 4H3YA 2HA8A 3IEFA 1V6ZA 1X7PA 4CNFB 2CX8A 1UAKA 3KY7A 3IC6A 3AI9X 3QUVA 1GZ0A 1V2XA 2I6DA 3DCMX 3L8UA 1UAJA 1VHYA 4IG6A 1UALA 1P9PA 3N4JA 1UAMA 1J85A 2QWVA 4E8BA 2O3AA 3N4KA 4H3ZA 3NK7A 3AIAA
chains in the KnotProt database with same CATH superfamily
1K3RA 1NXZA 3GYQA 1VHKA 3E5YA 1VH0A 3ONPA 3KNUA 3KTYA 2YY8A 1O6DA 2QMMA 1MXIA 4CNEB 3AXZA 4CNGB 1X7OA 1NS5A 2Z0YA 3ILKA 3NK6A 1TO0A 1ZJRA 4FAKA 4H3YA 2HA8A 3IEFA 1V6ZA 1X7PA 4CNFB 2CX8A 1UAKA 3KY7A 3IC6A 3AI9X 3QUVA 1GZ0A 1V2XA 2I6DA 3DCMX 3L8UA 1UAJA 1VHYA 4IG6A 1UALA 1P9PA 3N4JA 1UAMA 1J85A 2QWVA 4E8BA 2O3AA 3N4KA 4H3ZA 3NK7A 3AIAA
chains in the KnotProt database with same CATH topology
1K3RA 1NXZA 3GYQA 1VHKA 3E5YA 1VH0A 3ONPA 3KNUA 3KTYA 2YY8A 1O6DA 2QMMA 1MXIA 4CNEB 3AXZA 4CNGB 1X7OA 1NS5A 2Z0YA 3ILKA 3NK6A 1TO0A 1ZJRA 4FAKA 4H3YA 2HA8A 3IEFA 1V6ZA 1X7PA 4CNFB 2CX8A 1UAKA 3KY7A 3IC6A 3AI9X 3QUVA 1GZ0A 1V2XA 2I6DA 3DCMX 3L8UA 1UAJA 1VHYA 4IG6A 1UALA 1P9PA 3N4JA 1UAMA 1J85A 2QWVA 4E8BA 2O3AA 3N4KA 4H3ZA 3NK7A 3AIAA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1K3R A;  1NXZ A;  3GYQ A;  1VHK A;  3E5Y A;  1VH0 A;  3ONP A;  3KNU A;  3KTY A;  2YY8 A;  1O6D A;  2QMM A;  1MXI A;  4CNE B;  3AXZ A;  4CNG B;  1X7O A;  1NS5 A;  2Z0Y A;  3ILK A;  3NK6 A;  1TO0 A;  1ZJR A;  4FAK A;  4H3Y A;  2HA8 A;  3IEF A;  1V6Z A;  1X7P A;  4CNF B;  2CX8 A;  1UAK A;  3KY7 A;  3IC6 A;  3AI9 X;  3QUV A;  1GZ0 A;  1V2X A;  2I6D A;  3DCM X;  3L8U A;  1UAJ A;  1VHY A;  4IG6 A;  1UAL A;  1P9P A;  3N4J A;  1UAM A;  1J85 A;  2QWV A;  4E8B A;  2O3A A;  3N4K A;  4H3Z A;  3NK7 A;  3AIA A; 
#chains in the KnotProt database with same CATH topology
 1K3R A;  1NXZ A;  3GYQ A;  1VHK A;  3E5Y A;  1VH0 A;  3ONP A;  3KNU A;  3KTY A;  2YY8 A;  1O6D A;  2QMM A;  1MXI A;  4CNE B;  3AXZ A;  4CNG B;  1X7O A;  1NS5 A;  2Z0Y A;  3ILK A;  3NK6 A;  1TO0 A;  1ZJR A;  4FAK A;  4H3Y A;  2HA8 A;  3IEF A;  1V6Z A;  1X7P A;  4CNF B;  2CX8 A;  1UAK A;  3KY7 A;  3IC6 A;  3AI9 X;  3QUV A;  1GZ0 A;  1V2X A;  2I6D A;  3DCM X;  3L8U A;  1UAJ A;  1VHY A;  4IG6 A;  1UAL A;  1P9P A;  3N4J A;  1UAM A;  1J85 A;  2QWV A;  4E8B A;  2O3A A;  3N4K A;  4H3Z A;  3NK7 A;  3AIA A; 
#chains in the KnotProt database with same CATH homology
 1K3R A;  1NXZ A;  3GYQ A;  1VHK A;  3E5Y A;  1VH0 A;  3ONP A;  3KNU A;  3KTY A;  2YY8 A;  1O6D A;  2QMM A;  1MXI A;  4CNE B;  3AXZ A;  4CNG B;  1X7O A;  1NS5 A;  2Z0Y A;  3ILK A;  3NK6 A;  1TO0 A;  1ZJR A;  4FAK A;  4H3Y A;  2HA8 A;  3IEF A;  1V6Z A;  1X7P A;  4CNF B;  2CX8 A;  1UAK A;  3KY7 A;  3IC6 A;  3AI9 X;  3QUV A;  1GZ0 A;  1V2X A;  2I6D A;  3DCM X;  3L8U A;  1UAJ A;  1VHY A;  4IG6 A;  1UAL A;  1P9P A;  3N4J A;  1UAM A;  1J85 A;  2QWV A;  4E8B A;  2O3A A;  3N4K A;  4H3Z A;  3NK7 A;  3AIA A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling