3ILKA

The structure of a probable methylase family protein from haemophilus influenzae rd kw20
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 80-130 51 1-79, 131-240 79 110 knot
Chain Sequence
NAMLENIRIVLIETSHSGNIGSAARAMKTMGLTQLCLVSPKSVDEQSYALSAGAENIVKNARVVDSFDEAVDDCSLVIGTSARLRHLQNTLIEPRECAEKVVAYKGKIAIVFGRERIGLTNEELLKCHYHLNIPANPDYSSLNLAMAVQLVSYELRMAFLVQNNKKNSLSL-EKNYPTTDQLAYFFDYTERIYQSLGFIQNQGVMRKLKRLYYRAKLEKNELNILNGMLSAVEKRIDLTK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 79-131 53 1-78, 132-239 78 108 knot
view details
2.1 81-165 85 1-78, 183-239 79-80, 166-182 78 57 slipknot
view details
2.1 81-182 102 1-78, 206-239 79-80, 183-205 78 34 slipknot
sequence length 240
structure length 239
publication title The structure of a probable methylase family protein from Haemophilus influenzae Rd KW20
rcsb
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized tRNA/rRNA methyltransferase HI0380
source organism Haemophilus influenzae
missing residues 172
total genus Genus: 73
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-08-07
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3ilkA01
1NS5A 1UAJA 3KTYA 1ZJRA 3QUVA 3L8UA 3KNUA 1UAKA 3AI9X 4CNEB 1NXZA 3DCMX 4CNGB 3ONPA 2HA8A 3N4KA 4IG6A 3N4JA 3ILKA 1VHKA 3IC6A 1VH0A 3AXZA 1V2XA 1O6DA 1TO0A 1K3RA 1X7PA 1GZ0A 3AIAA 2CX8A 3GYQA 2I6DA 3IEFA 3NK6A 1J85A 1P9PA 1X7OA 4H3ZA 4FAKA 3NK7A 4H3YA 2YY8A 3KY7A 2O3AA 1V6ZA 1UAMA 2QWVA 4CNFB 4E8BA 1VHYA 2QMMA 1UALA 2Z0YA 3E5YA 1MXIA
chains in the KnotProt database with same CATH superfamily
1NS5A 1UAJA 3KTYA 1ZJRA 3QUVA 3L8UA 3KNUA 1UAKA 3AI9X 4CNEB 1NXZA 3DCMX 4CNGB 3ONPA 2HA8A 3N4KA 4IG6A 3N4JA 3ILKA 1VHKA 3IC6A 1VH0A 3AXZA 1V2XA 1O6DA 1TO0A 1K3RA 1X7PA 1GZ0A 3AIAA 2CX8A 3GYQA 2I6DA 3IEFA 3NK6A 1J85A 1P9PA 1X7OA 4H3ZA 4FAKA 3NK7A 4H3YA 2YY8A 3KY7A 2O3AA 1V6ZA 1UAMA 2QWVA 4CNFB 4E8BA 1VHYA 2QMMA 1UALA 2Z0YA 3E5YA 1MXIA
chains in the KnotProt database with same CATH topology
1NS5A 1UAJA 3KTYA 1ZJRA 3QUVA 3L8UA 3KNUA 1UAKA 3AI9X 4CNEB 1NXZA 3DCMX 4CNGB 3ONPA 2HA8A 3N4KA 4IG6A 3N4JA 3ILKA 1VHKA 3IC6A 1VH0A 3AXZA 1V2XA 1O6DA 1TO0A 1K3RA 1X7PA 1GZ0A 3AIAA 2CX8A 3GYQA 2I6DA 3IEFA 3NK6A 1J85A 1P9PA 1X7OA 4H3ZA 4FAKA 3NK7A 4H3YA 2YY8A 3KY7A 2O3AA 1V6ZA 1UAMA 2QWVA 4CNFB 4E8BA 1VHYA 2QMMA 1UALA 2Z0YA 3E5YA 1MXIA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1NS5 A;  1UAJ A;  3KTY A;  1ZJR A;  3QUV A;  3L8U A;  3KNU A;  1UAK A;  3AI9 X;  4CNE B;  1NXZ A;  3DCM X;  4CNG B;  3ONP A;  2HA8 A;  3N4K A;  4IG6 A;  3N4J A;  3ILK A;  1VHK A;  3IC6 A;  1VH0 A;  3AXZ A;  1V2X A;  1O6D A;  1TO0 A;  1K3R A;  1X7P A;  1GZ0 A;  3AIA A;  2CX8 A;  3GYQ A;  2I6D A;  3IEF A;  3NK6 A;  1J85 A;  1P9P A;  1X7O A;  4H3Z A;  4FAK A;  3NK7 A;  4H3Y A;  2YY8 A;  3KY7 A;  2O3A A;  1V6Z A;  1UAM A;  2QWV A;  4CNF B;  4E8B A;  1VHY A;  2QMM A;  1UAL A;  2Z0Y A;  3E5Y A;  1MXI A; 
#chains in the KnotProt database with same CATH topology
 1NS5 A;  1UAJ A;  3KTY A;  1ZJR A;  3QUV A;  3L8U A;  3KNU A;  1UAK A;  3AI9 X;  4CNE B;  1NXZ A;  3DCM X;  4CNG B;  3ONP A;  2HA8 A;  3N4K A;  4IG6 A;  3N4J A;  3ILK A;  1VHK A;  3IC6 A;  1VH0 A;  3AXZ A;  1V2X A;  1O6D A;  1TO0 A;  1K3R A;  1X7P A;  1GZ0 A;  3AIA A;  2CX8 A;  3GYQ A;  2I6D A;  3IEF A;  3NK6 A;  1J85 A;  1P9P A;  1X7O A;  4H3Z A;  4FAK A;  3NK7 A;  4H3Y A;  2YY8 A;  3KY7 A;  2O3A A;  1V6Z A;  1UAM A;  2QWV A;  4CNF B;  4E8B A;  1VHY A;  2QMM A;  1UAL A;  2Z0Y A;  3E5Y A;  1MXI A; 
#chains in the KnotProt database with same CATH homology
 1NS5 A;  1UAJ A;  3KTY A;  1ZJR A;  3QUV A;  3L8U A;  3KNU A;  1UAK A;  3AI9 X;  4CNE B;  1NXZ A;  3DCM X;  4CNG B;  3ONP A;  2HA8 A;  3N4K A;  4IG6 A;  3N4J A;  3ILK A;  1VHK A;  3IC6 A;  1VH0 A;  3AXZ A;  1V2X A;  1O6D A;  1TO0 A;  1K3R A;  1X7P A;  1GZ0 A;  3AIA A;  2CX8 A;  3GYQ A;  2I6D A;  3IEF A;  3NK6 A;  1J85 A;  1P9P A;  1X7O A;  4H3Z A;  4FAK A;  3NK7 A;  4H3Y A;  2YY8 A;  3KY7 A;  2O3A A;  1V6Z A;  1UAM A;  2QWV A;  4CNF B;  4E8B A;  1VHY A;  2QMM A;  1UAL A;  2Z0Y A;  3E5Y A;  1MXI A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling