4FAKA

Crystal structure of orfx in complex with s-adenosylmethionine
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 79-128 50 1-78, 129-163 78 35 knot
Chain Sequence
AAEFMKITILAVGKLKEKYWKQAIAEYEKRLGPYTKIDIIEVPDEKAPENMSDKEIEQVKEKEGQRILAKIKPQSTVITLEIQGKMLSSEGLAQELNQRMTQGQSDFVFVIGGSNGLHKDVLQRSNYALSFSKMTFPHQMMRVVLIEQVYRAFKIMRGEAYHK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 78-129 52 1-77, 130-163 77 34 knot
view details
2.1 80-154 75 1-77, 161-163 78-79, 155-160 77 3 slipknot
view details
3.1 80-160 81 1-77, 163-163 78-79, 161-162 77 1 slipknot
sequence length 163
structure length 163
publication title Characterization of the Staphylococcus aureus rRNA Methyltransferase Encoded by orfX, the Gene Containing the Staphylococcal Chromosome Cassette mec (SCCmec) Insertion Site.
pubmed doi rcsb
molecule tags Transferase, ribosomal protein
molecule keywords Ribosomal RNA large subunit methyltransferase H
source organism Staphylococcus aureus
total genus Genus: 53
ec nomenclature ec 2.1.1.177: 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase.
pdb deposition date 2012-05-22
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02590 SPOUT_MTase Predicted SPOUT methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4fakA00
3IEFA 2Z0YA 3KTYA 4CNGB 1GZ0A 1X7PA 3N4JA 1VHYA 1O6DA 4CNFB 2YY8A 1NXZA 1UAKA 2QWVA 4FAKA 1NS5A 1VH0A 3KNUA 1UALA 1UAMA 3QUVA 3AXZA 3NK7A 3N4KA 1V2XA 3ONPA 4IG6A 1MXIA 2HA8A 2CX8A 1VHKA 3ILKA 3AI9X 1J85A 3L8UA 4H3ZA 3DCMX 3NK6A 1ZJRA 2O3AA 4H3YA 1UAJA 4CNEB 3E5YA 1K3RA 1TO0A 1P9PA 1V6ZA 3AIAA 3GYQA 3KY7A 3IC6A 2I6DA 1X7OA 2QMMA 4E8BA
chains in the KnotProt database with same CATH superfamily
3IEFA 2Z0YA 3KTYA 4CNGB 1GZ0A 1X7PA 3N4JA 1VHYA 1O6DA 4CNFB 2YY8A 1NXZA 1UAKA 2QWVA 4FAKA 1NS5A 1VH0A 3KNUA 1UALA 1UAMA 3QUVA 3AXZA 3NK7A 3N4KA 1V2XA 3ONPA 4IG6A 1MXIA 2HA8A 2CX8A 1VHKA 3ILKA 3AI9X 1J85A 3L8UA 4H3ZA 3DCMX 3NK6A 1ZJRA 2O3AA 4H3YA 1UAJA 4CNEB 3E5YA 1K3RA 1TO0A 1P9PA 1V6ZA 3AIAA 3GYQA 3KY7A 3IC6A 2I6DA 1X7OA 2QMMA 4E8BA
chains in the KnotProt database with same CATH topology
3IEFA 2Z0YA 3KTYA 4CNGB 1GZ0A 1X7PA 3N4JA 1VHYA 1O6DA 4CNFB 2YY8A 1NXZA 1UAKA 2QWVA 4FAKA 1NS5A 1VH0A 3KNUA 1UALA 1UAMA 3QUVA 3AXZA 3NK7A 3N4KA 1V2XA 3ONPA 4IG6A 1MXIA 2HA8A 2CX8A 1VHKA 3ILKA 3AI9X 1J85A 3L8UA 4H3ZA 3DCMX 3NK6A 1ZJRA 2O3AA 4H3YA 1UAJA 4CNEB 3E5YA 1K3RA 1TO0A 1P9PA 1V6ZA 3AIAA 3GYQA 3KY7A 3IC6A 2I6DA 1X7OA 2QMMA 4E8BA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3IEF A;  2Z0Y A;  3KTY A;  4CNG B;  1GZ0 A;  1X7P A;  3N4J A;  1VHY A;  1O6D A;  4CNF B;  2YY8 A;  1NXZ A;  1UAK A;  2QWV A;  4FAK A;  1NS5 A;  1VH0 A;  3KNU A;  1UAL A;  1UAM A;  3QUV A;  3AXZ A;  3NK7 A;  3N4K A;  1V2X A;  3ONP A;  4IG6 A;  1MXI A;  2HA8 A;  2CX8 A;  1VHK A;  3ILK A;  3AI9 X;  1J85 A;  3L8U A;  4H3Z A;  3DCM X;  3NK6 A;  1ZJR A;  2O3A A;  4H3Y A;  1UAJ A;  4CNE B;  3E5Y A;  1K3R A;  1TO0 A;  1P9P A;  1V6Z A;  3AIA A;  3GYQ A;  3KY7 A;  3IC6 A;  2I6D A;  1X7O A;  2QMM A;  4E8B A; 
#chains in the KnotProt database with same CATH topology
 3IEF A;  2Z0Y A;  3KTY A;  4CNG B;  1GZ0 A;  1X7P A;  3N4J A;  1VHY A;  1O6D A;  4CNF B;  2YY8 A;  1NXZ A;  1UAK A;  2QWV A;  4FAK A;  1NS5 A;  1VH0 A;  3KNU A;  1UAL A;  1UAM A;  3QUV A;  3AXZ A;  3NK7 A;  3N4K A;  1V2X A;  3ONP A;  4IG6 A;  1MXI A;  2HA8 A;  2CX8 A;  1VHK A;  3ILK A;  3AI9 X;  1J85 A;  3L8U A;  4H3Z A;  3DCM X;  3NK6 A;  1ZJR A;  2O3A A;  4H3Y A;  1UAJ A;  4CNE B;  3E5Y A;  1K3R A;  1TO0 A;  1P9P A;  1V6Z A;  3AIA A;  3GYQ A;  3KY7 A;  3IC6 A;  2I6D A;  1X7O A;  2QMM A;  4E8B A; 
#chains in the KnotProt database with same CATH homology
 3IEF A;  2Z0Y A;  3KTY A;  4CNG B;  1GZ0 A;  1X7P A;  3N4J A;  1VHY A;  1O6D A;  4CNF B;  2YY8 A;  1NXZ A;  1UAK A;  2QWV A;  4FAK A;  1NS5 A;  1VH0 A;  3KNU A;  1UAL A;  1UAM A;  3QUV A;  3AXZ A;  3NK7 A;  3N4K A;  1V2X A;  3ONP A;  4IG6 A;  1MXI A;  2HA8 A;  2CX8 A;  1VHK A;  3ILK A;  3AI9 X;  1J85 A;  3L8U A;  4H3Z A;  3DCM X;  3NK6 A;  1ZJR A;  2O3A A;  4H3Y A;  1UAJ A;  4CNE B;  3E5Y A;  1K3R A;  1TO0 A;  1P9P A;  1V6Z A;  3AIA A;  3GYQ A;  3KY7 A;  3IC6 A;  2I6D A;  1X7O A;  2QMM A;  4E8B A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling