4FAKA

Crystal structure of orfx in complex with s-adenosylmethionine
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 79-128 50 1-78, 129-163 78 35 knot
Chain Sequence
AAEFMKITILAVGKLKEKYWKQAIAEYEKRLGPYTKIDIIEVPDEKAPENMSDKEIEQVKEKEGQRILAKIKPQSTVITLEIQGKMLSSEGLAQELNQRMTQGQSDFVFVIGGSNGLHKDVLQRSNYALSFSKMTFPHQMMRVVLIEQVYRAFKIMRGEAYHK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 78-129 52 1-77, 130-163 77 34 knot
view details
2.1 80-154 75 1-77, 161-163 78-79, 155-160 77 3 slipknot
view details
3.1 80-160 81 1-77, 163-163 78-79, 161-162 77 1 slipknot
sequence length 163
structure length 163
publication title Characterization of the Staphylococcus aureus rRNA Methyltransferase Encoded by orfX, the Gene Containing the Staphylococcal Chromosome Cassette mec (SCCmec) Insertion Site.
pubmed doi rcsb
molecule tags Transferase, ribosomal protein
molecule keywords Ribosomal RNA large subunit methyltransferase H
source organism Staphylococcus aureus
total genus Genus: 53
ec nomenclature ec 2.1.1.177: 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase.
pdb deposition date 2012-05-22
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02590 SPOUT_MTase Predicted SPOUT methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4fakA00
1V6ZA 2CX8A 4H3YA 1VHKA 2QWVA 2QMMA 1VH0A 1UALA 1UAMA 4E8BA 1V2XA 1J85A 3GYQA 4CNEB 1P9PA 1VHYA 3ONPA 3NK7A 1UAKA 3NK6A 1NXZA 1UAJA 4FAKA 3KTYA 3L8UA 4CNFB 4CNGB 3N4JA 1MXIA 2I6DA 3AI9X 4IG6A 1GZ0A 1X7OA 3AXZA 3IEFA 2Z0YA 3QUVA 3DCMX 1IPAA 2O3AA 2HA8A 3N4KA 1ZJRA 3KY7A 3E5YA 1NS5A 1TO0A 3AIAA 1O6DA 3IC6A 3ILKA 3KNUA 1K3RA 2YY8A 1X7PA 4H3ZA
chains in the KnotProt database with same CATH superfamily
1V6ZA 2CX8A 4H3YA 1VHKA 2QWVA 2QMMA 1VH0A 1UALA 1UAMA 4E8BA 1V2XA 1J85A 3GYQA 4CNEB 1P9PA 1VHYA 3ONPA 3NK7A 1UAKA 3NK6A 1NXZA 1UAJA 4FAKA 3KTYA 3L8UA 4CNFB 4CNGB 3N4JA 1MXIA 2I6DA 3AI9X 4IG6A 1GZ0A 1X7OA 3AXZA 3IEFA 2Z0YA 3QUVA 3DCMX 1IPAA 2O3AA 2HA8A 3N4KA 1ZJRA 3KY7A 3E5YA 1NS5A 1TO0A 3AIAA 1O6DA 3IC6A 3ILKA 3KNUA 1K3RA 2YY8A 1X7PA 4H3ZA
chains in the KnotProt database with same CATH topology
1V6ZA 2CX8A 4H3YA 1VHKA 2QWVA 2QMMA 1VH0A 1UALA 1UAMA 4E8BA 1V2XA 1J85A 3GYQA 4CNEB 1P9PA 1VHYA 3ONPA 3NK7A 1UAKA 3NK6A 1NXZA 1UAJA 4FAKA 3KTYA 3L8UA 4CNFB 4CNGB 3N4JA 1MXIA 2I6DA 3AI9X 4IG6A 1GZ0A 1X7OA 3AXZA 3IEFA 2Z0YA 3QUVA 3DCMX 1IPAA 2O3AA 2HA8A 3N4KA 1ZJRA 3KY7A 3E5YA 1NS5A 1TO0A 3AIAA 1O6DA 3IC6A 3ILKA 3KNUA 1K3RA 2YY8A 1X7PA 4H3ZA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1V6Z A;  2CX8 A;  4H3Y A;  1VHK A;  2QWV A;  2QMM A;  1VH0 A;  1UAL A;  1UAM A;  4E8B A;  1V2X A;  1J85 A;  3GYQ A;  4CNE B;  1P9P A;  1VHY A;  3ONP A;  3NK7 A;  1UAK A;  3NK6 A;  1NXZ A;  1UAJ A;  4FAK A;  3KTY A;  3L8U A;  4CNF B;  4CNG B;  3N4J A;  1MXI A;  2I6D A;  3AI9 X;  4IG6 A;  1GZ0 A;  1X7O A;  3AXZ A;  3IEF A;  2Z0Y A;  3QUV A;  3DCM X;  1IPA A;  2O3A A;  2HA8 A;  3N4K A;  1ZJR A;  3KY7 A;  3E5Y A;  1NS5 A;  1TO0 A;  3AIA A;  1O6D A;  3IC6 A;  3ILK A;  3KNU A;  1K3R A;  2YY8 A;  1X7P A;  4H3Z A; 
#chains in the KnotProt database with same CATH topology
 1V6Z A;  2CX8 A;  4H3Y A;  1VHK A;  2QWV A;  2QMM A;  1VH0 A;  1UAL A;  1UAM A;  4E8B A;  1V2X A;  1J85 A;  3GYQ A;  4CNE B;  1P9P A;  1VHY A;  3ONP A;  3NK7 A;  1UAK A;  3NK6 A;  1NXZ A;  1UAJ A;  4FAK A;  3KTY A;  3L8U A;  4CNF B;  4CNG B;  3N4J A;  1MXI A;  2I6D A;  3AI9 X;  4IG6 A;  1GZ0 A;  1X7O A;  3AXZ A;  3IEF A;  2Z0Y A;  3QUV A;  3DCM X;  1IPA A;  2O3A A;  2HA8 A;  3N4K A;  1ZJR A;  3KY7 A;  3E5Y A;  1NS5 A;  1TO0 A;  3AIA A;  1O6D A;  3IC6 A;  3ILK A;  3KNU A;  1K3R A;  2YY8 A;  1X7P A;  4H3Z A; 
#chains in the KnotProt database with same CATH homology
 1V6Z A;  2CX8 A;  4H3Y A;  1VHK A;  2QWV A;  2QMM A;  1VH0 A;  1UAL A;  1UAM A;  4E8B A;  1V2X A;  1J85 A;  3GYQ A;  4CNE B;  1P9P A;  1VHY A;  3ONP A;  3NK7 A;  1UAK A;  3NK6 A;  1NXZ A;  1UAJ A;  4FAK A;  3KTY A;  3L8U A;  4CNF B;  4CNG B;  3N4J A;  1MXI A;  2I6D A;  3AI9 X;  4IG6 A;  1GZ0 A;  1X7O A;  3AXZ A;  3IEF A;  2Z0Y A;  3QUV A;  3DCM X;  1IPA A;  2O3A A;  2HA8 A;  3N4K A;  1ZJR A;  3KY7 A;  3E5Y A;  1NS5 A;  1TO0 A;  3AIA A;  1O6D A;  3IC6 A;  3ILK A;  3KNU A;  1K3R A;  2YY8 A;  1X7P A;  4H3Z A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling