1UAKA

Crystal structure of trna(m1g37)methyltransferase: insight into trna recognition
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 89-132 44 1-88, 133-252 88 120 knot
Chain Sequence
SHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVL---------SFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNSLEHH
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 88-133 46 1-87, 134-243 87 110 knot
sequence length 252
structure length 243
publication title Crystal structure of tRNA(m(1)G37)methyltransferase: insights into tRNA recognition
pubmed doi rcsb
molecule tags Transferase
molecule keywords tRNA (Guanine-N(1)-)-methyltransferase
source organism Haemophilus influenzae
missing residues 163-171
total genus Genus: 71
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2003-03-11
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 1uakA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1uakA01
4CNEB 1UALA 2QMMA 3AIAA 3NK6A 3ONPA 2O3AA 1J85A 1VH0A 1P9PA 1GZ0A 3KTYA 4H3ZA 1VHYA 1NXZA 3NK7A 3IEFA 4CNGB 3AI9X 2I6DA 1VHKA 2HA8A 3AXZA 1MXIA 1X7OA 4IG6A 3GYQA 2YY8A 3KNUA 1O6DA 1UAMA 3DCMX 4H3YA 3QUVA 3N4KA 1NS5A 1K3RA 3L8UA 3E5YA 1V2XA 3IC6A 1UAKA 3ILKA 3KY7A 1UAJA 1TO0A 1ZJRA 4CNFB 1V6ZA 2QWVA 4E8BA 2Z0YA 3N4JA 1X7PA 2CX8A 4FAKA
chains in the KnotProt database with same CATH superfamily
4CNEB 1UALA 2QMMA 3AIAA 3NK6A 3ONPA 2O3AA 1J85A 1VH0A 1P9PA 1GZ0A 3KTYA 4H3ZA 1VHYA 1NXZA 3NK7A 3IEFA 4CNGB 3AI9X 2I6DA 1VHKA 2HA8A 3AXZA 1MXIA 1X7OA 4IG6A 3GYQA 2YY8A 3KNUA 1O6DA 1UAMA 3DCMX 4H3YA 3QUVA 3N4KA 1NS5A 1K3RA 3L8UA 3E5YA 1V2XA 3IC6A 1UAKA 3ILKA 3KY7A 1UAJA 1TO0A 1ZJRA 4CNFB 1V6ZA 2QWVA 4E8BA 2Z0YA 3N4JA 1X7PA 2CX8A 4FAKA
chains in the KnotProt database with same CATH topology
4CNEB 1UALA 2QMMA 3AIAA 3NK6A 3ONPA 2O3AA 1J85A 1VH0A 1P9PA 1GZ0A 3KTYA 4H3ZA 1VHYA 1NXZA 3NK7A 3IEFA 4CNGB 3AI9X 2I6DA 1VHKA 2HA8A 3AXZA 1MXIA 1X7OA 4IG6A 3GYQA 2YY8A 3KNUA 1O6DA 1UAMA 3DCMX 4H3YA 3QUVA 3N4KA 1NS5A 1K3RA 3L8UA 3E5YA 1V2XA 3IC6A 1UAKA 3ILKA 3KY7A 1UAJA 1TO0A 1ZJRA 4CNFB 1V6ZA 2QWVA 4E8BA 2Z0YA 3N4JA 1X7PA 2CX8A 4FAKA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 4CNE B;  1UAL A;  2QMM A;  3AIA A;  3NK6 A;  3ONP A;  2O3A A;  1J85 A;  1VH0 A;  1P9P A;  1GZ0 A;  3KTY A;  4H3Z A;  1VHY A;  1NXZ A;  3NK7 A;  3IEF A;  4CNG B;  3AI9 X;  2I6D A;  1VHK A;  2HA8 A;  3AXZ A;  1MXI A;  1X7O A;  4IG6 A;  3GYQ A;  2YY8 A;  3KNU A;  1O6D A;  1UAM A;  3DCM X;  4H3Y A;  3QUV A;  3N4K A;  1NS5 A;  1K3R A;  3L8U A;  3E5Y A;  1V2X A;  3IC6 A;  1UAK A;  3ILK A;  3KY7 A;  1UAJ A;  1TO0 A;  1ZJR A;  4CNF B;  1V6Z A;  2QWV A;  4E8B A;  2Z0Y A;  3N4J A;  1X7P A;  2CX8 A;  4FAK A; 
#chains in the KnotProt database with same CATH topology
 4CNE B;  1UAL A;  2QMM A;  3AIA A;  3NK6 A;  3ONP A;  2O3A A;  1J85 A;  1VH0 A;  1P9P A;  1GZ0 A;  3KTY A;  4H3Z A;  1VHY A;  1NXZ A;  3NK7 A;  3IEF A;  4CNG B;  3AI9 X;  2I6D A;  1VHK A;  2HA8 A;  3AXZ A;  1MXI A;  1X7O A;  4IG6 A;  3GYQ A;  2YY8 A;  3KNU A;  1O6D A;  1UAM A;  3DCM X;  4H3Y A;  3QUV A;  3N4K A;  1NS5 A;  1K3R A;  3L8U A;  3E5Y A;  1V2X A;  3IC6 A;  1UAK A;  3ILK A;  3KY7 A;  1UAJ A;  1TO0 A;  1ZJR A;  4CNF B;  1V6Z A;  2QWV A;  4E8B A;  2Z0Y A;  3N4J A;  1X7P A;  2CX8 A;  4FAK A; 
#chains in the KnotProt database with same CATH homology
 4CNE B;  1UAL A;  2QMM A;  3AIA A;  3NK6 A;  3ONP A;  2O3A A;  1J85 A;  1VH0 A;  1P9P A;  1GZ0 A;  3KTY A;  4H3Z A;  1VHY A;  1NXZ A;  3NK7 A;  3IEF A;  4CNG B;  3AI9 X;  2I6D A;  1VHK A;  2HA8 A;  3AXZ A;  1MXI A;  1X7O A;  4IG6 A;  3GYQ A;  2YY8 A;  3KNU A;  1O6D A;  1UAM A;  3DCM X;  4H3Y A;  3QUV A;  3N4K A;  1NS5 A;  1K3R A;  3L8U A;  3E5Y A;  1V2X A;  3IC6 A;  1UAK A;  3ILK A;  3KY7 A;  1UAJ A;  1TO0 A;  1ZJR A;  4CNF B;  1V6Z A;  2QWV A;  4E8B A;  2Z0Y A;  3N4J A;  1X7P A;  2CX8 A;  4FAK A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling