2I6DA

The structure of a putative rna methyltransferase of the trmh family from porphyromonas gingivalis.
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 179-221 43 1-178, 222-255 178 34 knot
Chain Sequence
AMLSANQIKFLRSLRERKYRLREQAFAVEGPKLVGEMLPFYRCRMLVGTAAMLRAVSTPHDAEVVELPESFDFKRISTQTTPQPLMAVFDLPAEPEPVVEGLTLLLDGVQDPGNVGTILRTADWFGIRHVWLGTGSADVFSPKVVQASMGALARVQPTPLKNTVDTLAYFRRQGIPVYGAFLDGQSLYEAPLPNFTEPAILVLGSEGRGISPEVAAEITDRLTIPASGLSV----ESLNVAIATAILCSEWRRRS
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 178-224 47 1-177, 225-251 177 27 knot
view details
2.1 178-218 41 1-177 225-251 219-224 177 27 slipknot
view details
3.1 179-224 46 225-251 1-177 178-178 177 26 slipknot
view details
3.1 181-234 54 1-178, 242-251 179-180, 235-241 178 10 slipknot
view details
3.1 180-242 63 243-251 1-178 179-179 178 8 slipknot
view details
3.1 181-243 63 1-179, 251-251 180-180, 244-250 179 1 slipknot
sequence length 255
structure length 251
publication title The structure of a putative RNA methyltransferase of the TrmH family from Porphyromonas gingivalis.
rcsb
molecule tags Transferase
molecule keywords RNA methyltransferase, TrmH family
source organism Porphyromonas gingivalis
missing residues 232-235
total genus Genus: 73
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-08-28
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2i6dA01
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 2i6dA02
4CNEB 1UALA 3NK6A 2QMMA 3AIAA 3ONPA 2O3AA 1J85A 1VH0A 1P9PA 1GZ0A 3KTYA 4H3ZA 1VHYA 1NXZA 3NK7A 3IEFA 4CNGB 3AI9X 2I6DA 1VHKA 2HA8A 3AXZA 1MXIA 1X7OA 3GYQA 4IG6A 2YY8A 3KNUA 1O6DA 1UAMA 3DCMX 4H3YA 3QUVA 3N4KA 1NS5A 1K3RA 3L8UA 3E5YA 1V2XA 3IC6A 1UAKA 3ILKA 3KY7A 1UAJA 1TO0A 1ZJRA 4CNFB 1V6ZA 2QWVA 4E8BA 2Z0YA 3N4JA 1X7PA 2CX8A 4FAKA
chains in the KnotProt database with same CATH superfamily
4CNEB 1UALA 3NK6A 2QMMA 3AIAA 3ONPA 2O3AA 1J85A 1VH0A 1P9PA 1GZ0A 3KTYA 4H3ZA 1VHYA 1NXZA 3NK7A 3IEFA 4CNGB 3AI9X 2I6DA 1VHKA 2HA8A 3AXZA 1MXIA 1X7OA 3GYQA 4IG6A 2YY8A 3KNUA 1O6DA 1UAMA 3DCMX 4H3YA 3QUVA 3N4KA 1NS5A 1K3RA 3L8UA 3E5YA 1V2XA 3IC6A 1UAKA 3ILKA 3KY7A 1UAJA 1TO0A 1ZJRA 4CNFB 1V6ZA 2QWVA 4E8BA 2Z0YA 3N4JA 1X7PA 2CX8A 4FAKA
chains in the KnotProt database with same CATH topology
4CNEB 1UALA 3NK6A 2QMMA 3AIAA 3ONPA 2O3AA 1J85A 1VH0A 1P9PA 1GZ0A 3KTYA 4H3ZA 1VHYA 1NXZA 3NK7A 3IEFA 4CNGB 3AI9X 2I6DA 1VHKA 2HA8A 3AXZA 1MXIA 1X7OA 3GYQA 4IG6A 2YY8A 3KNUA 1O6DA 1UAMA 3DCMX 4H3YA 3QUVA 3N4KA 1NS5A 1K3RA 3L8UA 3E5YA 1V2XA 3IC6A 1UAKA 3ILKA 3KY7A 1UAJA 1TO0A 1ZJRA 4CNFB 1V6ZA 2QWVA 4E8BA 2Z0YA 3N4JA 1X7PA 2CX8A 4FAKA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 4CNE B;  1UAL A;  3NK6 A;  2QMM A;  3AIA A;  3ONP A;  2O3A A;  1J85 A;  1VH0 A;  1P9P A;  1GZ0 A;  3KTY A;  4H3Z A;  1VHY A;  1NXZ A;  3NK7 A;  3IEF A;  4CNG B;  3AI9 X;  2I6D A;  1VHK A;  2HA8 A;  3AXZ A;  1MXI A;  1X7O A;  3GYQ A;  4IG6 A;  2YY8 A;  3KNU A;  1O6D A;  1UAM A;  3DCM X;  4H3Y A;  3QUV A;  3N4K A;  1NS5 A;  1K3R A;  3L8U A;  3E5Y A;  1V2X A;  3IC6 A;  1UAK A;  3ILK A;  3KY7 A;  1UAJ A;  1TO0 A;  1ZJR A;  4CNF B;  1V6Z A;  2QWV A;  4E8B A;  2Z0Y A;  3N4J A;  1X7P A;  2CX8 A;  4FAK A; 
#chains in the KnotProt database with same CATH topology
 4CNE B;  1UAL A;  3NK6 A;  2QMM A;  3AIA A;  3ONP A;  2O3A A;  1J85 A;  1VH0 A;  1P9P A;  1GZ0 A;  3KTY A;  4H3Z A;  1VHY A;  1NXZ A;  3NK7 A;  3IEF A;  4CNG B;  3AI9 X;  2I6D A;  1VHK A;  2HA8 A;  3AXZ A;  1MXI A;  1X7O A;  3GYQ A;  4IG6 A;  2YY8 A;  3KNU A;  1O6D A;  1UAM A;  3DCM X;  4H3Y A;  3QUV A;  3N4K A;  1NS5 A;  1K3R A;  3L8U A;  3E5Y A;  1V2X A;  3IC6 A;  1UAK A;  3ILK A;  3KY7 A;  1UAJ A;  1TO0 A;  1ZJR A;  4CNF B;  1V6Z A;  2QWV A;  4E8B A;  2Z0Y A;  3N4J A;  1X7P A;  2CX8 A;  4FAK A; 
#chains in the KnotProt database with same CATH homology
 4CNE B;  1UAL A;  3NK6 A;  2QMM A;  3AIA A;  3ONP A;  2O3A A;  1J85 A;  1VH0 A;  1P9P A;  1GZ0 A;  3KTY A;  4H3Z A;  1VHY A;  1NXZ A;  3NK7 A;  3IEF A;  4CNG B;  3AI9 X;  2I6D A;  1VHK A;  2HA8 A;  3AXZ A;  1MXI A;  1X7O A;  3GYQ A;  4IG6 A;  2YY8 A;  3KNU A;  1O6D A;  1UAM A;  3DCM X;  4H3Y A;  3QUV A;  3N4K A;  1NS5 A;  1K3R A;  3L8U A;  3E5Y A;  1V2X A;  3IC6 A;  1UAK A;  3ILK A;  3KY7 A;  1UAJ A;  1TO0 A;  1ZJR A;  4CNF B;  1V6Z A;  2QWV A;  4E8B A;  2Z0Y A;  3N4J A;  1X7P A;  2CX8 A;  4FAK A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling