3AIAA

Crystal structure of duf358 reveals a putative spout-class methltransferase
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 135-176 42 1-134, 177-200 134 24 knot
Chain Sequence
MREFIFKANKTITSSDINLKDLPGSCGRLDLLCRCVSDAFFLSHDIRRDVVFYAVLYGQPNPPVCIKFVGSELKKVSPDERNIAIFIKKALKKFEELDEEQRKDWNQSTPGIYVRRLGFRNLVLEKLEEGKNIYYLHMNGEDVENVDIENPVFIIGDHIGIGEEDERFLDEIKAKRISLSPLELHANHCITIIHNVLDKK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 134-177 44 1-133, 178-200 133 23 knot
view details
3.1 135-178 44 1-133, 196-200 134-134, 179-195 133 5 slipknot
sequence length 200
structure length 200
publication title Crystal structure of Mj1640/DUF358 protein reveals a putative SPOUT-class RNA methyltransferase
pubmed doi rcsb
molecule tags Transferase
molecule keywords UPF0217 protein MJ1640
source organism Methanocaldococcus jannaschii
total genus Genus: 69
ec nomenclature ec 2.1.1.257: tRNA (pseudouridine(54)-N(1))-methyltransferase.
pdb deposition date 2010-05-11
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04013 Methyltrn_RNA_2 Putative SAM-dependent RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3aiaA00
2YY8A 3AI9X 3AIAA 1P9PA 1UAKA 4H3ZA 1O6DA 3N4KA 1K3RA 3GYQA 3L8UA 3NK7A 3DCMX 2QWVA 3NK6A 3IC6A 1V2XA 1X7OA 3KY7A 4FAKA 4IG6A 1UAJA 3AXZA 1V6ZA 1TO0A 1GZ0A 3ONPA 1J85A 3ILKA 2CX8A 1NS5A 2QMMA 3QUVA 3E5YA 4H3YA 1UALA 1VHKA 1VHYA 1X7PA 4CNGB 1MXIA 4CNEB 2I6DA 3IEFA 4E8BA 3N4JA 1NXZA 4CNFB 1VH0A 2HA8A 3KNUA 2O3AA 2Z0YA 1ZJRA 1UAMA 3KTYA
chains in the KnotProt database with same CATH superfamily
2YY8A 3AI9X 3AIAA 1P9PA 1UAKA 4H3ZA 1O6DA 3N4KA 1K3RA 3GYQA 3L8UA 3NK7A 3DCMX 2QWVA 3NK6A 3IC6A 1V2XA 1X7OA 3KY7A 4FAKA 4IG6A 1UAJA 3AXZA 1V6ZA 1TO0A 1GZ0A 3ONPA 1J85A 3ILKA 2CX8A 1NS5A 2QMMA 3QUVA 3E5YA 4H3YA 1UALA 1VHKA 1VHYA 1X7PA 4CNGB 1MXIA 4CNEB 2I6DA 3IEFA 4E8BA 3N4JA 1NXZA 4CNFB 1VH0A 2HA8A 3KNUA 2O3AA 2Z0YA 1ZJRA 1UAMA 3KTYA
chains in the KnotProt database with same CATH topology
2YY8A 3AI9X 3AIAA 1P9PA 1UAKA 4H3ZA 1O6DA 3N4KA 1K3RA 3GYQA 3L8UA 3NK7A 3DCMX 2QWVA 3NK6A 3IC6A 1V2XA 1X7OA 3KY7A 4FAKA 4IG6A 1UAJA 3AXZA 1V6ZA 1TO0A 1GZ0A 3ONPA 1J85A 3ILKA 2CX8A 1NS5A 2QMMA 3QUVA 3E5YA 4H3YA 1UALA 1VHKA 1VHYA 1X7PA 4CNGB 1MXIA 4CNEB 2I6DA 3IEFA 4E8BA 3N4JA 1NXZA 4CNFB 1VH0A 2HA8A 3KNUA 2O3AA 2Z0YA 1ZJRA 1UAMA 3KTYA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2YY8 A;  3AI9 X;  3AIA A;  1P9P A;  1UAK A;  4H3Z A;  1O6D A;  3N4K A;  1K3R A;  3GYQ A;  3L8U A;  3NK7 A;  3DCM X;  2QWV A;  3NK6 A;  3IC6 A;  1V2X A;  1X7O A;  3KY7 A;  4FAK A;  4IG6 A;  1UAJ A;  3AXZ A;  1V6Z A;  1TO0 A;  1GZ0 A;  3ONP A;  1J85 A;  3ILK A;  2CX8 A;  1NS5 A;  2QMM A;  3QUV A;  3E5Y A;  4H3Y A;  1UAL A;  1VHK A;  1VHY A;  1X7P A;  4CNG B;  1MXI A;  4CNE B;  2I6D A;  3IEF A;  4E8B A;  3N4J A;  1NXZ A;  4CNF B;  1VH0 A;  2HA8 A;  3KNU A;  2O3A A;  2Z0Y A;  1ZJR A;  1UAM A;  3KTY A; 
#chains in the KnotProt database with same CATH topology
 2YY8 A;  3AI9 X;  3AIA A;  1P9P A;  1UAK A;  4H3Z A;  1O6D A;  3N4K A;  1K3R A;  3GYQ A;  3L8U A;  3NK7 A;  3DCM X;  2QWV A;  3NK6 A;  3IC6 A;  1V2X A;  1X7O A;  3KY7 A;  4FAK A;  4IG6 A;  1UAJ A;  3AXZ A;  1V6Z A;  1TO0 A;  1GZ0 A;  3ONP A;  1J85 A;  3ILK A;  2CX8 A;  1NS5 A;  2QMM A;  3QUV A;  3E5Y A;  4H3Y A;  1UAL A;  1VHK A;  1VHY A;  1X7P A;  4CNG B;  1MXI A;  4CNE B;  2I6D A;  3IEF A;  4E8B A;  3N4J A;  1NXZ A;  4CNF B;  1VH0 A;  2HA8 A;  3KNU A;  2O3A A;  2Z0Y A;  1ZJR A;  1UAM A;  3KTY A; 
#chains in the KnotProt database with same CATH homology
 2YY8 A;  3AI9 X;  3AIA A;  1P9P A;  1UAK A;  4H3Z A;  1O6D A;  3N4K A;  1K3R A;  3GYQ A;  3L8U A;  3NK7 A;  3DCM X;  2QWV A;  3NK6 A;  3IC6 A;  1V2X A;  1X7O A;  3KY7 A;  4FAK A;  4IG6 A;  1UAJ A;  3AXZ A;  1V6Z A;  1TO0 A;  1GZ0 A;  3ONP A;  1J85 A;  3ILK A;  2CX8 A;  1NS5 A;  2QMM A;  3QUV A;  3E5Y A;  4H3Y A;  1UAL A;  1VHK A;  1VHY A;  1X7P A;  4CNG B;  1MXI A;  4CNE B;  2I6D A;  3IEF A;  4E8B A;  3N4J A;  1NXZ A;  4CNF B;  1VH0 A;  2HA8 A;  3KNU A;  2O3A A;  2Z0Y A;  1ZJR A;  1UAM A;  3KTY A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling