3AIAA

Crystal structure of duf358 reveals a putative spout-class methltransferase
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 135-176 42 1-134, 177-200 134 24 knot
Chain Sequence
MREFIFKANKTITSSDINLKDLPGSCGRLDLLCRCVSDAFFLSHDIRRDVVFYAVLYGQPNPPVCIKFVGSELKKVSPDERNIAIFIKKALKKFEELDEEQRKDWNQSTPGIYVRRLGFRNLVLEKLEEGKNIYYLHMNGEDVENVDIENPVFIIGDHIGIGEEDERFLDEIKAKRISLSPLELHANHCITIIHNVLDKK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 134-177 44 1-133, 178-200 133 23 knot
view details
3.1 135-178 44 1-133, 196-200 134-134, 179-195 133 5 slipknot
sequence length 200
structure length 200
publication title Crystal structure of Mj1640/DUF358 protein reveals a putative SPOUT-class RNA methyltransferase
pubmed doi rcsb
molecule tags Transferase
molecule keywords UPF0217 protein MJ1640
source organism Methanocaldococcus jannaschii
total genus Genus: 69
ec nomenclature ec 2.1.1.257: tRNA (pseudouridine(54)-N(1))-methyltransferase.
pdb deposition date 2010-05-11
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04013 Methyltrn_RNA_2 Putative SAM-dependent RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3aiaA00
2Z0YA 1NS5A 1J85A 3KY7A 3ONPA 2CX8A 3DCMX 1O6DA 1V6ZA 4H3ZA 1VH0A 3N4JA 4CNFB 1V2XA 1VHKA 1UAMA 1GZ0A 1UAJA 2I6DA 3IC6A 3AI9X 3NK6A 4CNGB 3L8UA 4FAKA 1P9PA 4E8BA 3ILKA 4H3YA 2HA8A 2O3AA 3NK7A 1MXIA 3IEFA 1X7OA 3AXZA 1K3RA 1VHYA 1ZJRA 2QWVA 3GYQA 1UAKA 3QUVA 4IG6A 3KNUA 1X7PA 3N4KA 1NXZA 1UALA 2QMMA 3AIAA 3E5YA 4CNEB 3KTYA 2YY8A 1TO0A
chains in the KnotProt database with same CATH superfamily
2Z0YA 1NS5A 1J85A 3KY7A 3ONPA 2CX8A 3DCMX 1O6DA 1V6ZA 4H3ZA 1VH0A 3N4JA 4CNFB 1V2XA 1VHKA 1UAMA 1GZ0A 1UAJA 2I6DA 3IC6A 3AI9X 3NK6A 4CNGB 3L8UA 4FAKA 1P9PA 4E8BA 3ILKA 4H3YA 2HA8A 2O3AA 3NK7A 1MXIA 3IEFA 1X7OA 3AXZA 1K3RA 1VHYA 1ZJRA 2QWVA 3GYQA 1UAKA 3QUVA 4IG6A 3KNUA 1X7PA 3N4KA 1NXZA 1UALA 2QMMA 3AIAA 3E5YA 4CNEB 3KTYA 2YY8A 1TO0A
chains in the KnotProt database with same CATH topology
2Z0YA 1NS5A 1J85A 3KY7A 3ONPA 2CX8A 3DCMX 1O6DA 1V6ZA 4H3ZA 1VH0A 3N4JA 4CNFB 1V2XA 1VHKA 1UAMA 1GZ0A 1UAJA 2I6DA 3IC6A 3AI9X 3NK6A 4CNGB 3L8UA 4FAKA 1P9PA 4E8BA 3ILKA 4H3YA 2HA8A 2O3AA 3NK7A 1MXIA 3IEFA 1X7OA 3AXZA 1K3RA 1VHYA 1ZJRA 2QWVA 3GYQA 1UAKA 3QUVA 4IG6A 3KNUA 1X7PA 3N4KA 1NXZA 1UALA 2QMMA 3AIAA 3E5YA 4CNEB 3KTYA 2YY8A 1TO0A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 2Z0Y A;  1NS5 A;  1J85 A;  3KY7 A;  3ONP A;  2CX8 A;  3DCM X;  1O6D A;  1V6Z A;  4H3Z A;  1VH0 A;  3N4J A;  4CNF B;  1V2X A;  1VHK A;  1UAM A;  1GZ0 A;  1UAJ A;  2I6D A;  3IC6 A;  3AI9 X;  3NK6 A;  4CNG B;  3L8U A;  4FAK A;  1P9P A;  4E8B A;  3ILK A;  4H3Y A;  2HA8 A;  2O3A A;  3NK7 A;  1MXI A;  3IEF A;  1X7O A;  3AXZ A;  1K3R A;  1VHY A;  1ZJR A;  2QWV A;  3GYQ A;  1UAK A;  3QUV A;  4IG6 A;  3KNU A;  1X7P A;  3N4K A;  1NXZ A;  1UAL A;  2QMM A;  3AIA A;  3E5Y A;  4CNE B;  3KTY A;  2YY8 A;  1TO0 A; 
#chains in the KnotProt database with same CATH topology
 2Z0Y A;  1NS5 A;  1J85 A;  3KY7 A;  3ONP A;  2CX8 A;  3DCM X;  1O6D A;  1V6Z A;  4H3Z A;  1VH0 A;  3N4J A;  4CNF B;  1V2X A;  1VHK A;  1UAM A;  1GZ0 A;  1UAJ A;  2I6D A;  3IC6 A;  3AI9 X;  3NK6 A;  4CNG B;  3L8U A;  4FAK A;  1P9P A;  4E8B A;  3ILK A;  4H3Y A;  2HA8 A;  2O3A A;  3NK7 A;  1MXI A;  3IEF A;  1X7O A;  3AXZ A;  1K3R A;  1VHY A;  1ZJR A;  2QWV A;  3GYQ A;  1UAK A;  3QUV A;  4IG6 A;  3KNU A;  1X7P A;  3N4K A;  1NXZ A;  1UAL A;  2QMM A;  3AIA A;  3E5Y A;  4CNE B;  3KTY A;  2YY8 A;  1TO0 A; 
#chains in the KnotProt database with same CATH homology
 2Z0Y A;  1NS5 A;  1J85 A;  3KY7 A;  3ONP A;  2CX8 A;  3DCM X;  1O6D A;  1V6Z A;  4H3Z A;  1VH0 A;  3N4J A;  4CNF B;  1V2X A;  1VHK A;  1UAM A;  1GZ0 A;  1UAJ A;  2I6D A;  3IC6 A;  3AI9 X;  3NK6 A;  4CNG B;  3L8U A;  4FAK A;  1P9P A;  4E8B A;  3ILK A;  4H3Y A;  2HA8 A;  2O3A A;  3NK7 A;  1MXI A;  3IEF A;  1X7O A;  3AXZ A;  1K3R A;  1VHY A;  1ZJR A;  2QWV A;  3GYQ A;  1UAK A;  3QUV A;  4IG6 A;  3KNU A;  1X7P A;  3N4K A;  1NXZ A;  1UAL A;  2QMM A;  3AIA A;  3E5Y A;  4CNE B;  3KTY A;  2YY8 A;  1TO0 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling