4CNFB

Crystal structure of sulfolobus acidocaldarius trmj
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 75-127 53 1-74, 128-156 74 29 knot
Chain Sequence
MTIRLVIVEPEGAYNLGFIARLVKNFLIDEFYVVNPKADINEAIKFSAKGSEVIEKMMKITNNFDDAIRDVDLKIATSSIADI-----RKSIRPIDLERLIKDKKVAFIFGRESVGLTREEIAKSDFLLFIPANPEYPVLNLSHAVGIVLYELWRN
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 76-124 49 1-75, 125-151 75 27 knot
view details
2.1 74-120 47 1-73 127-151 121-126 73 25 slipknot
sequence length 156
structure length 151
publication title Characterization of Two Homologous 2'-O-Methyltransferases Showing Different Specificities for Their tRNA Substrates.
pubmed doi rcsb
molecule tags Transferase
molecule keywords SPOU RRNA METHYLASE
source organism Sulfolobus acidocaldarius
missing residues 84-88
ec nomenclature ec 2.1.1.200: tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase.
pdb deposition date 2014-01-22
KnotProt deposition date 2018-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4cnfB00
3E5YA 4E8BA 2O3AA 3AI9X 3IEFA 3KY7A 1V6ZA 3N4KA 1UAMA 1O6DA 1ZJRA 1UAKA 3L8UA 3NK7A 3KNUA 1TO0A 1V2XA 4CNFB 1VHYA 1X7OA 1NXZA 1VH0A 1P9PA 1VHKA 3IC6A 3AXZA 3ILKA 1NS5A 3ONPA 1X7PA 2QMMA 3DCMX 2I6DA 3NK6A 1GZ0A 2HA8A 4FAKA 4IG6A 1UALA 1J85A 4H3YA 3KTYA 2CX8A 3GYQA 3N4JA 3QUVA 1K3RA 2YY8A 3AIAA 2QWVA 4H3ZA 4CNGB 2Z0YA 4CNEB 1UAJA 1MXIA
chains in the KnotProt database with same CATH superfamily
3E5YA 4E8BA 2O3AA 3AI9X 3IEFA 3KY7A 1V6ZA 3N4KA 1UAMA 1O6DA 1ZJRA 1UAKA 3L8UA 3NK7A 3KNUA 1TO0A 1V2XA 4CNFB 1VHYA 1X7OA 1NXZA 1VH0A 1P9PA 1VHKA 3IC6A 3AXZA 3ILKA 1NS5A 3ONPA 1X7PA 2QMMA 3DCMX 2I6DA 3NK6A 1GZ0A 2HA8A 4FAKA 4IG6A 1UALA 1J85A 4H3YA 3KTYA 2CX8A 3GYQA 3N4JA 3QUVA 1K3RA 2YY8A 3AIAA 2QWVA 4H3ZA 4CNGB 2Z0YA 4CNEB 1UAJA 1MXIA
chains in the KnotProt database with same CATH topology
3E5YA 4E8BA 2O3AA 3AI9X 3IEFA 3KY7A 1V6ZA 3N4KA 1UAMA 1O6DA 1ZJRA 1UAKA 3L8UA 3NK7A 3KNUA 1TO0A 1V2XA 4CNFB 1VHYA 1X7OA 1NXZA 1VH0A 1P9PA 1VHKA 3IC6A 3AXZA 3ILKA 1NS5A 3ONPA 1X7PA 2QMMA 3DCMX 2I6DA 3NK6A 1GZ0A 2HA8A 4FAKA 4IG6A 1UALA 1J85A 4H3YA 3KTYA 2CX8A 3GYQA 3N4JA 3QUVA 1K3RA 2YY8A 3AIAA 2QWVA 4H3ZA 4CNGB 2Z0YA 4CNEB 1UAJA 1MXIA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3E5Y A;  4E8B A;  2O3A A;  3AI9 X;  3IEF A;  3KY7 A;  1V6Z A;  3N4K A;  1UAM A;  1O6D A;  1ZJR A;  1UAK A;  3L8U A;  3NK7 A;  3KNU A;  1TO0 A;  1V2X A;  4CNF B;  1VHY A;  1X7O A;  1NXZ A;  1VH0 A;  1P9P A;  1VHK A;  3IC6 A;  3AXZ A;  3ILK A;  1NS5 A;  3ONP A;  1X7P A;  2QMM A;  3DCM X;  2I6D A;  3NK6 A;  1GZ0 A;  2HA8 A;  4FAK A;  4IG6 A;  1UAL A;  1J85 A;  4H3Y A;  3KTY A;  2CX8 A;  3GYQ A;  3N4J A;  3QUV A;  1K3R A;  2YY8 A;  3AIA A;  2QWV A;  4H3Z A;  4CNG B;  2Z0Y A;  4CNE B;  1UAJ A;  1MXI A; 
#chains in the KnotProt database with same CATH topology
 3E5Y A;  4E8B A;  2O3A A;  3AI9 X;  3IEF A;  3KY7 A;  1V6Z A;  3N4K A;  1UAM A;  1O6D A;  1ZJR A;  1UAK A;  3L8U A;  3NK7 A;  3KNU A;  1TO0 A;  1V2X A;  4CNF B;  1VHY A;  1X7O A;  1NXZ A;  1VH0 A;  1P9P A;  1VHK A;  3IC6 A;  3AXZ A;  3ILK A;  1NS5 A;  3ONP A;  1X7P A;  2QMM A;  3DCM X;  2I6D A;  3NK6 A;  1GZ0 A;  2HA8 A;  4FAK A;  4IG6 A;  1UAL A;  1J85 A;  4H3Y A;  3KTY A;  2CX8 A;  3GYQ A;  3N4J A;  3QUV A;  1K3R A;  2YY8 A;  3AIA A;  2QWV A;  4H3Z A;  4CNG B;  2Z0Y A;  4CNE B;  1UAJ A;  1MXI A; 
#chains in the KnotProt database with same CATH homology
 3E5Y A;  4E8B A;  2O3A A;  3AI9 X;  3IEF A;  3KY7 A;  1V6Z A;  3N4K A;  1UAM A;  1O6D A;  1ZJR A;  1UAK A;  3L8U A;  3NK7 A;  3KNU A;  1TO0 A;  1V2X A;  4CNF B;  1VHY A;  1X7O A;  1NXZ A;  1VH0 A;  1P9P A;  1VHK A;  3IC6 A;  3AXZ A;  3ILK A;  1NS5 A;  3ONP A;  1X7P A;  2QMM A;  3DCM X;  2I6D A;  3NK6 A;  1GZ0 A;  2HA8 A;  4FAK A;  4IG6 A;  1UAL A;  1J85 A;  4H3Y A;  3KTY A;  2CX8 A;  3GYQ A;  3N4J A;  3QUV A;  1K3R A;  2YY8 A;  3AIA A;  2QWV A;  4H3Z A;  4CNG B;  2Z0Y A;  4CNE B;  1UAJ A;  1MXI A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling