1AUKA

Human arylsulfatase a
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 7-263 257 1-6 294-485 264-293 6 192 slipknot
Chain Sequence
RPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLXTPSRAALLTGRLPVRMGMYPGVLVPSSRGGLPLEEVTVAEVLAARGYLTGMAGKWHLGVGPEGAFLPPHQGFHRFLGIPYSHDQGPCQNLTCFPPATPCDGGCDQGLVPIPLLANLSVEAQPPWLPGLEARYMAFAHDLMADAQRQDRPFFLYYASHHTHYPQFSGQSFAERSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIFTADNGPETMRMSRGGCSGLLRCGKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPLPNVTLDGFDLSPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGENYNLLG----ATPEVLQALKQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 7-265 259 1-6 275-481 266-274 6 207 slipknot
view details
2.1 6-275 270 1-5 292-481 276-291 5 190 slipknot
view details
2.1 8-281 274 1-5, 292-481 6-7, 282-291 5 190 slipknot
sequence length 485
structure length 481
publication title Crystal structure of human arylsulfatase A: the aldehyde function and the metal ion at the active site suggest a novel mechanism for sulfate ester hydrolysis.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ARYLSULFATASE A
source organism Homo sapiens
missing residues 426-429
total genus Genus: 154
ec nomenclature ec 3.1.6.8: Cerebroside-sulfatase.
pdb deposition date 1997-08-29
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.10 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 1aukA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1aukA01
1AUKA 1E2SP 1HQAA 1AJCA 3M8WA 3BDGB 2IFYA 3BDGA 3IGYB 1ED8A 1E33P 3UN5A 3BDFA 1Y7AA 1KHLA 1O98A 3UO0A 3CMRA 2GA3A 1E1ZP 3MK2A 1N2LA 1KHNA 1Y6VA 3T01A 3ED4A 3M8YA 1ALIA 3SZYA 1ALKA 4FDJA 3MK0A 1ZEDA 3NVLA 3BDHA 1URAA 1EI6A 3MK1A 3TWZA 1URBA 1AJBA 1ELYA 1ED9A 1ZEFA 1KH5A 3TX0A 1O99A 3IGZB 1EJJA 3T02A 1P49A 1KH4A 1HDHA 3M7VA 3T00A 3UNYA 1SHQA 1ALHA 3DYCA 3DPCA 1N2KA 1KH9A 2QZUA 2GLQA 1ZEBA 1EW2A 1ANIA 3SZZA 1K7HA 3UN3A 1HJKA 1ALJA 1E3CP 1EW9A 1FSUA 1ANJA 1ELXA 1ELZA 1SHNA 1EQJA 1AJAA 2G9YA 1EW8A 3M8ZA 1AJDA 1KH7A 1KHKA 1B8JA 3UN2A 4FDIA 1KHJA 2ANHA 3OT9A
chains in the KnotProt database with same CATH superfamily
1AUKA 1E2SP 1HQAA 1AJCA 3M8WA 3BDGB 2IFYA 3BDGA 3IGYB 1ED8A 1E33P 3UN5A 3BDFA 1Y7AA 1KHLA 1O98A 3UO0A 3CMRA 2GA3A 1E1ZP 3MK2A 1N2LA 1KHNA 1Y6VA 3T01A 3ED4A 3M8YA 1ALIA 3SZYA 1ALKA 4FDJA 3MK0A 1ZEDA 3NVLA 3BDHA 1URAA 1EI6A 3MK1A 3TWZA 1URBA 1AJBA 1ELYA 1ED9A 1ZEFA 1KH5A 3TX0A 1O99A 3IGZB 1EJJA 3T02A 1P49A 1KH4A 1HDHA 3M7VA 3T00A 3UNYA 1SHQA 1ALHA 3DYCA 3DPCA 1N2KA 1KH9A 2QZUA 2GLQA 1ZEBA 1EW2A 1ANIA 3SZZA 1K7HA 3UN3A 1HJKA 1ALJA 1E3CP 1EW9A 1FSUA 1ANJA 1ELXA 1ELZA 1SHNA 1EQJA 1AJAA 2G9YA 1EW8A 3M8ZA 1AJDA 1KH7A 1KHKA 1B8JA 3UN2A 4FDIA 1KHJA 2ANHA 3OT9A
chains in the KnotProt database with same CATH topology
1AUKA 1E2SP 1HQAA 1AJCA 3M8WA 3BDGB 2IFYA 3BDGA 3IGYB 1ED8A 1E33P 3UN5A 3BDFA 1Y7AA 1KHLA 1O98A 3UO0A 3CMRA 2GA3A 1E1ZP 3MK2A 1N2LA 1KHNA 1Y6VA 3T01A 3ED4A 3M8YA 1ALIA 3SZYA 1ALKA 4FDJA 3MK0A 1ZEDA 3NVLA 3BDHA 1URAA 1EI6A 3MK1A 3TWZA 1URBA 1AJBA 1ELYA 1ED9A 1ZEFA 1KH5A 3TX0A 1O99A 3IGZB 1EJJA 3T02A 1P49A 1KH4A 1HDHA 3M7VA 3T00A 3UNYA 1SHQA 1ALHA 3DYCA 3DPCA 1N2KA 1KH9A 2QZUA 2GLQA 1ZEBA 1EW2A 1ANIA 3SZZA 1K7HA 3UN3A 1HJKA 1ALJA 1E3CP 1EW9A 1FSUA 1ANJA 1ELXA 1ELZA 1SHNA 1EQJA 1AJAA 2G9YA 1EW8A 3M8ZA 1AJDA 1KH7A 1KHKA 1B8JA 3UN2A 4FDIA 1KHJA 2ANHA 3OT9A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1AUK A;  1E2S P;  1HQA A;  1AJC A;  3M8W A;  3BDG B;  2IFY A;  3BDG A;  3IGY B;  1ED8 A;  1E33 P;  3UN5 A;  3BDF A;  1Y7A A;  1KHL A;  1O98 A;  3UO0 A;  3CMR A;  2GA3 A;  1E1Z P;  3MK2 A;  1N2L A;  1KHN A;  1Y6V A;  3T01 A;  3ED4 A;  3M8Y A;  1ALI A;  3SZY A;  1ALK A;  4FDJ A;  3MK0 A;  1ZED A;  3NVL A;  3BDH A;  1URA A;  1EI6 A;  3MK1 A;  3TWZ A;  1URB A;  1AJB A;  1ELY A;  1ED9 A;  1ZEF A;  1KH5 A;  3TX0 A;  1O99 A;  3IGZ B;  1EJJ A;  3T02 A;  1P49 A;  1KH4 A;  1HDH A;  3M7V A;  3T00 A;  3UNY A;  1SHQ A;  1ALH A;  3DYC A;  3DPC A;  1N2K A;  1KH9 A;  2QZU A;  2GLQ A;  1ZEB A;  1EW2 A;  1ANI A;  3SZZ A;  1K7H A;  3UN3 A;  1HJK A;  1ALJ A;  1E3C P;  1EW9 A;  1FSU A;  1ANJ A;  1ELX A;  1ELZ A;  1SHN A;  1EQJ A;  1AJA A;  2G9Y A;  1EW8 A;  3M8Z A;  1AJD A;  1KH7 A;  1KHK A;  1B8J A;  3UN2 A;  4FDI A;  1KHJ A;  2ANH A;  3OT9 A; 
#chains in the KnotProt database with same CATH topology
 1AUK A;  1E2S P;  1HQA A;  1AJC A;  3M8W A;  3BDG B;  2IFY A;  3BDG A;  3IGY B;  1ED8 A;  1E33 P;  3UN5 A;  3BDF A;  1Y7A A;  1KHL A;  1O98 A;  3UO0 A;  3CMR A;  2GA3 A;  1E1Z P;  3MK2 A;  1N2L A;  1KHN A;  1Y6V A;  3T01 A;  3ED4 A;  3M8Y A;  1ALI A;  3SZY A;  1ALK A;  4FDJ A;  3MK0 A;  1ZED A;  3NVL A;  3BDH A;  1URA A;  1EI6 A;  3MK1 A;  3TWZ A;  1URB A;  1AJB A;  1ELY A;  1ED9 A;  1ZEF A;  1KH5 A;  3TX0 A;  1O99 A;  3IGZ B;  1EJJ A;  3T02 A;  1P49 A;  1KH4 A;  1HDH A;  3M7V A;  3T00 A;  3UNY A;  1SHQ A;  1ALH A;  3DYC A;  3DPC A;  1N2K A;  1KH9 A;  2QZU A;  2GLQ A;  1ZEB A;  1EW2 A;  1ANI A;  3SZZ A;  1K7H A;  3UN3 A;  1HJK A;  1ALJ A;  1E3C P;  1EW9 A;  1FSU A;  1ANJ A;  1ELX A;  1ELZ A;  1SHN A;  1EQJ A;  1AJA A;  2G9Y A;  1EW8 A;  3M8Z A;  1AJD A;  1KH7 A;  1KHK A;  1B8J A;  3UN2 A;  4FDI A;  1KHJ A;  2ANH A;  3OT9 A; 
#chains in the KnotProt database with same CATH homology
 1AUK A;  1E2S P;  1HQA A;  1AJC A;  3M8W A;  3BDG B;  2IFY A;  3BDG A;  3IGY B;  1ED8 A;  1E33 P;  3UN5 A;  3BDF A;  1Y7A A;  1KHL A;  1O98 A;  3UO0 A;  3CMR A;  2GA3 A;  1E1Z P;  3MK2 A;  1N2L A;  1KHN A;  1Y6V A;  3T01 A;  3ED4 A;  3M8Y A;  1ALI A;  3SZY A;  1ALK A;  4FDJ A;  3MK0 A;  1ZED A;  3NVL A;  3BDH A;  1URA A;  1EI6 A;  3MK1 A;  3TWZ A;  1URB A;  1AJB A;  1ELY A;  1ED9 A;  1ZEF A;  1KH5 A;  3TX0 A;  1O99 A;  3IGZ B;  1EJJ A;  3T02 A;  1P49 A;  1KH4 A;  1HDH A;  3M7V A;  3T00 A;  3UNY A;  1SHQ A;  1ALH A;  3DYC A;  3DPC A;  1N2K A;  1KH9 A;  2QZU A;  2GLQ A;  1ZEB A;  1EW2 A;  1ANI A;  3SZZ A;  1K7H A;  3UN3 A;  1HJK A;  1ALJ A;  1E3C P;  1EW9 A;  1FSU A;  1ANJ A;  1ELX A;  1ELZ A;  1SHN A;  1EQJ A;  1AJA A;  2G9Y A;  1EW8 A;  3M8Z A;  1AJD A;  1KH7 A;  1KHK A;  1B8J A;  3UN2 A;  4FDI A;  1KHJ A;  2ANH A;  3OT9 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling