3TWZA

Phosphorylated bacillus cereus phosphopentomutase in space group p212121
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 6-325 320 1-5 342-391 326-341 5 50 slipknot
Chain Sequence
KYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDTMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNELK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 8-329 322 1-7 335-391 330-334 7 57 slipknot
view details
3.1 6-334 329 1-5 338-391 335-337 5 54 slipknot
view details
2.1 9-327 319 1-5, 332-391 6-8, 328-331 5 60 slipknot
sequence length 391
structure length 391
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords Phosphopentomutase
source organism Bacillus cereus
total genus Genus: 139
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-09-22
KnotProt deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3twzA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3twzA01
1ELXA 1EW9A 1HQAA 1KHKA 1KH9A 1N2KA 1URAA 1ALKA 1SHQA 1K7HA 3IGYB 1AJBA 1AJDA 1AUKA 1KH7A 3M8ZA 1SHNA 1URBA 2GLQA 3MK1A 3M8YA 3T01A 1EQJA 3T00A 1E33P 3OT9A 3SZZA 1ALJA 1E2SP 3UN2A 1ELZA 3BDGA 1AJAA 1ALIA 1ZEFA 3NVLA 3T02A 1HJKA 1ED8A 1EJJA 3DPCA 1ZEBA 3TWZA 1E3CP 3BDHA 1Y6VA 2QZUA 2GA3A 1KHNA 1EW2A 1AJCA 1O98A 1O99A 1ED9A 1ANIA 1FSUA 3UNYA 3SZYA 3TX0A 1EI6A 1ZEDA 3MK2A 3CMRA 3UN5A 1ANJA 3DYCA 4FDIA 3M7VA 1HDHA 3MK0A 1N2LA 1KHJA 2ANHA 2IFYA 1KH5A 1P49A 4FDJA 3ED4A 3IGZB 1B8JA 3M8WA 3BDGB 3UN3A 1ELYA 3UO0A 1E1ZP 1EW8A 1KH4A 1Y7AA 2G9YA 1KHLA 3BDFA
chains in the KnotProt database with same CATH superfamily
1ELXA 1EW9A 1HQAA 1KHKA 1KH9A 1N2KA 1URAA 1ALKA 1SHQA 1K7HA 3IGYB 1AJBA 1AJDA 1AUKA 1KH7A 3M8ZA 1SHNA 1URBA 2GLQA 3MK1A 3M8YA 3T01A 1EQJA 3T00A 1E33P 3OT9A 3SZZA 1ALJA 1E2SP 3UN2A 1ELZA 3BDGA 1AJAA 1ALIA 1ZEFA 3NVLA 3T02A 1HJKA 1ED8A 1EJJA 3DPCA 3D7SB 1ZEBA 3TWZA 1E3CP 3BDHA 1Y6VA 2QZUA 2GA3A 1KHNA 1EW2A 1AJCA 1O98A 1O99A 1ED9A 1ANIA 1FSUA 3UNYA 3D7SD 3SZYA 3TX0A 1EI6A 1ZEDA 3MK2A 3CMRA 3UN5A 1ANJA 3DYCA 4FDIA 3M7VA 1HDHA 3MK0A 1N2LA 1KHJA 2ANHA 2IFYA 1KH5A 1P49A 4FDJA 3ED4A 3IGZB 1B8JA 3M8WA 3BDGB 3UN3A 1ELYA 3UO0A 1E1ZP 1EW8A 1KH4A 1Y7AA 2G9YA 1KHLA 3BDFA
chains in the KnotProt database with same CATH topology
1ELXA 1EW9A 1HQAA 1KHKA 1KH9A 1N2KA 1URAA 1ALKA 1SHQA 1K7HA 3IGYB 1AJBA 1AJDA 1AUKA 1KH7A 3M8ZA 1SHNA 1URBA 2GLQA 3MK1A 3M8YA 3T01A 1EQJA 3T00A 1E33P 3OT9A 3SZZA 1ALJA 1E2SP 3UN2A 1ELZA 3BDGA 1AJAA 1ALIA 1ZEFA 3NVLA 3T02A 1HJKA 1ED8A 1EJJA 3DPCA 1ZEBA 3TWZA 1E3CP 3BDHA 1Y6VA 2QZUA 2GA3A 1KHNA 1EW2A 1AJCA 1O98A 1O99A 1ED9A 1ANIA 1FSUA 3UNYA 3SZYA 3TX0A 1EI6A 1ZEDA 3MK2A 3CMRA 3UN5A 1ANJA 3DYCA 4FDIA 3M7VA 1HDHA 3MK0A 1N2LA 1KHJA 2ANHA 2IFYA 1KH5A 1P49A 4FDJA 3ED4A 3IGZB 1B8JA 3M8WA 3BDGB 3UN3A 1ELYA 3UO0A 1E1ZP 1EW8A 1KH4A 1Y7AA 2G9YA 1KHLA 3BDFA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1ELX A;  1EW9 A;  1HQA A;  1KHK A;  1KH9 A;  1N2K A;  1URA A;  1ALK A;  1SHQ A;  1K7H A;  3IGY B;  1AJB A;  1AJD A;  1AUK A;  1KH7 A;  3M8Z A;  1SHN A;  1URB A;  2GLQ A;  3MK1 A;  3M8Y A;  3T01 A;  1EQJ A;  3T00 A;  1E33 P;  3OT9 A;  3SZZ A;  1ALJ A;  1E2S P;  3UN2 A;  1ELZ A;  3BDG A;  1AJA A;  1ALI A;  1ZEF A;  3NVL A;  3T02 A;  1HJK A;  1ED8 A;  1EJJ A;  3DPC A;  1ZEB A;  3TWZ A;  1E3C P;  3BDH A;  1Y6V A;  2QZU A;  2GA3 A;  1KHN A;  1EW2 A;  1AJC A;  1O98 A;  1O99 A;  1ED9 A;  1ANI A;  1FSU A;  3UNY A;  3SZY A;  3TX0 A;  1EI6 A;  1ZED A;  3MK2 A;  3CMR A;  3UN5 A;  1ANJ A;  3DYC A;  4FDI A;  3M7V A;  1HDH A;  3MK0 A;  1N2L A;  1KHJ A;  2ANH A;  2IFY A;  1KH5 A;  1P49 A;  4FDJ A;  3ED4 A;  3IGZ B;  1B8J A;  3M8W A;  3BDG B;  3UN3 A;  1ELY A;  3UO0 A;  1E1Z P;  1EW8 A;  1KH4 A;  1Y7A A;  2G9Y A;  1KHL A;  3BDF A; 
#chains in the KnotProt database with same CATH topology
 1ELX A;  1EW9 A;  1HQA A;  1KHK A;  1KH9 A;  1N2K A;  1URA A;  1ALK A;  1SHQ A;  1K7H A;  3IGY B;  1AJB A;  1AJD A;  1AUK A;  1KH7 A;  3M8Z A;  1SHN A;  1URB A;  2GLQ A;  3MK1 A;  3M8Y A;  3T01 A;  1EQJ A;  3T00 A;  1E33 P;  3OT9 A;  3SZZ A;  1ALJ A;  1E2S P;  3UN2 A;  1ELZ A;  3BDG A;  1AJA A;  1ALI A;  1ZEF A;  3NVL A;  3T02 A;  1HJK A;  1ED8 A;  1EJJ A;  3DPC A;  3D7S B;  1ZEB A;  3TWZ A;  1E3C P;  3BDH A;  1Y6V A;  2QZU A;  2GA3 A;  1KHN A;  1EW2 A;  1AJC A;  1O98 A;  1O99 A;  1ED9 A;  1ANI A;  1FSU A;  3UNY A;  3D7S D;  3SZY A;  3TX0 A;  1EI6 A;  1ZED A;  3MK2 A;  3CMR A;  3UN5 A;  1ANJ A;  3DYC A;  4FDI A;  3M7V A;  1HDH A;  3MK0 A;  1N2L A;  1KHJ A;  2ANH A;  2IFY A;  1KH5 A;  1P49 A;  4FDJ A;  3ED4 A;  3IGZ B;  1B8J A;  3M8W A;  3BDG B;  3UN3 A;  1ELY A;  3UO0 A;  1E1Z P;  1EW8 A;  1KH4 A;  1Y7A A;  2G9Y A;  1KHL A;  3BDF A; 
#chains in the KnotProt database with same CATH homology
 1ELX A;  1EW9 A;  1HQA A;  1KHK A;  1KH9 A;  1N2K A;  1URA A;  1ALK A;  1SHQ A;  1K7H A;  3IGY B;  1AJB A;  1AJD A;  1AUK A;  1KH7 A;  3M8Z A;  1SHN A;  1URB A;  2GLQ A;  3MK1 A;  3M8Y A;  3T01 A;  1EQJ A;  3T00 A;  1E33 P;  3OT9 A;  3SZZ A;  1ALJ A;  1E2S P;  3UN2 A;  1ELZ A;  3BDG A;  1AJA A;  1ALI A;  1ZEF A;  3NVL A;  3T02 A;  1HJK A;  1ED8 A;  1EJJ A;  3DPC A;  1ZEB A;  3TWZ A;  1E3C P;  3BDH A;  1Y6V A;  2QZU A;  2GA3 A;  1KHN A;  1EW2 A;  1AJC A;  1O98 A;  1O99 A;  1ED9 A;  1ANI A;  1FSU A;  3UNY A;  3SZY A;  3TX0 A;  1EI6 A;  1ZED A;  3MK2 A;  3CMR A;  3UN5 A;  1ANJ A;  3DYC A;  4FDI A;  3M7V A;  1HDH A;  3MK0 A;  1N2L A;  1KHJ A;  2ANH A;  2IFY A;  1KH5 A;  1P49 A;  4FDJ A;  3ED4 A;  3IGZ B;  1B8J A;  3M8W A;  3BDG B;  3UN3 A;  1ELY A;  3UO0 A;  1E1Z P;  1EW8 A;  1KH4 A;  1Y7A A;  2G9Y A;  1KHL A;  3BDF A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling