1E33P

Crystal structure of an arylsulfatase a mutant p426l
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 7-263 257 1-6 294-485 264-293 6 192 slipknot
Chain Sequence
RPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLXTPSRAALLTGRLPVRMGMYPGVLVPSSRGGLPLEEVTVAEVLAARGYLTGMAGKWHLGVGPEGAFLPPHQGFHRFLGIPYSHDQGPCQNLTCFPPATPCDGGCDQGLVPIPLLANLSVEAQPPWLPGLEARYMAFAHDLMADAQREDRPFFLYYASHHTHYPQFSGQSFAERSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIFTADNGPETMRMSRGGCSGLLRCGKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPLPNVTLDGFDLSPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSLTAHEPLLLYDLSKDPGENYNLLG----ATPEVLQALKQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 5-261 257 1-4 267-481 262-266 4 215 slipknot
view details
3.1 7-266 260 1-6 294-481 267-293 6 188 slipknot
view details
3.1 6-293 288 1-5 295-481 294-294 5 187 slipknot
view details
2.1 6-294 289 1-5 296-481 295-295 5 186 slipknot
sequence length 485
structure length 481
publication title Defective Oligomerization of Arylsulfatase a as a Cause of its Instability in Lysosomes and Metachromatic Leukodystrophy.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ARYLSULFATASE A
missing residues 426-429
total genus Genus: 153
ec nomenclature ec 3.1.6.8: Cerebroside-sulfatase.
pdb deposition date 2000-06-06
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.10 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 1e33P02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1e33P01
1HDHA 2IFYA 1KH5A 1O99A 1KHNA 1URAA 2GA3A 1ELXA 1AJAA 3BDGB 1EW2A 1Y7AA 1HJKA 1URBA 1KHKA 1AUKA 2QZUA 3UNYA 1HQAA 3IGZB 2GLQA 1EQJA 3UN3A 1N2LA 1FSUA 1EI6A 1ALHA 3UO0A 1P49A 3SZZA 3MK2A 3T00A 1ZEDA 4FDIA 3M7VA 3TWZA 1ELZA 3BDHA 3BDGA 1KH4A 1AJDA 1B8JA 1KHJA 1ED8A 3ED4A 3NVLA 3SZYA 1E1ZP 3DYCA 3M8WA 3CMRA 3T01A 1K7HA 1ED9A 1O98A 1ZEBA 3M8ZA 1EW8A 1ANJA 1KH7A 1N2KA 4FDJA 1Y6VA 3BDFA 1AJCA 3OT9A 1ELYA 1KH9A 1KHLA 3UN5A 1ZEFA 2G9YA 1E2SP 1EJJA 3MK0A 1ANIA 1E3CP 1ALIA 3MK1A 3T02A 1EW9A 3UN2A 3M8YA 1ALKA 3DPCA 1SHQA 3IGYB 1ALJA 1SHNA 2ANHA 3TX0A 1AJBA 1E33P
chains in the KnotProt database with same CATH superfamily
1HDHA 2IFYA 1KH5A 1O99A 1KHNA 1URAA 2GA3A 1ELXA 1AJAA 3BDGB 1EW2A 1Y7AA 1HJKA 1URBA 1KHKA 1AUKA 2QZUA 3UNYA 1HQAA 3IGZB 2GLQA 1EQJA 3UN3A 1N2LA 1FSUA 1EI6A 1ALHA 3UO0A 1P49A 3SZZA 3MK2A 3T00A 1ZEDA 4FDIA 3M7VA 3TWZA 1ELZA 3BDHA 3BDGA 1KH4A 1AJDA 1B8JA 1KHJA 1ED8A 3ED4A 3NVLA 3SZYA 1E1ZP 3DYCA 3M8WA 3CMRA 3T01A 1K7HA 1ED9A 1O98A 1ZEBA 3M8ZA 1EW8A 1ANJA 1KH7A 1N2KA 4FDJA 1Y6VA 3BDFA 1AJCA 3OT9A 1ELYA 1KH9A 1KHLA 3UN5A 1ZEFA 2G9YA 1E2SP 1EJJA 3MK0A 1ANIA 1E3CP 1ALIA 3MK1A 3T02A 1EW9A 3UN2A 3M8YA 1ALKA 3DPCA 1SHQA 3IGYB 1ALJA 1SHNA 2ANHA 3TX0A 1AJBA 1E33P
chains in the KnotProt database with same CATH topology
1HDHA 2IFYA 1KH5A 1O99A 1KHNA 1URAA 2GA3A 1ELXA 1AJAA 3BDGB 1EW2A 1Y7AA 1HJKA 1URBA 1KHKA 1AUKA 2QZUA 3UNYA 1HQAA 3IGZB 2GLQA 1EQJA 3UN3A 1N2LA 1FSUA 1EI6A 1ALHA 3UO0A 1P49A 3SZZA 3MK2A 3T00A 1ZEDA 4FDIA 3M7VA 3TWZA 1ELZA 3BDHA 3BDGA 1KH4A 1AJDA 1B8JA 1KHJA 1ED8A 3ED4A 3NVLA 3SZYA 1E1ZP 3DYCA 3M8WA 3CMRA 3T01A 1K7HA 1ED9A 1O98A 1ZEBA 3M8ZA 1EW8A 1ANJA 1KH7A 1N2KA 4FDJA 1Y6VA 3BDFA 1AJCA 3OT9A 1ELYA 1KH9A 1KHLA 3UN5A 1ZEFA 2G9YA 1E2SP 1EJJA 3MK0A 1ANIA 1E3CP 1ALIA 3MK1A 3T02A 1EW9A 3UN2A 3M8YA 1ALKA 3DPCA 1SHQA 3IGYB 1ALJA 1SHNA 2ANHA 3TX0A 1AJBA 1E33P
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1HDH A;  2IFY A;  1KH5 A;  1O99 A;  1KHN A;  1URA A;  2GA3 A;  1ELX A;  1AJA A;  3BDG B;  1EW2 A;  1Y7A A;  1HJK A;  1URB A;  1KHK A;  1AUK A;  2QZU A;  3UNY A;  1HQA A;  3IGZ B;  2GLQ A;  1EQJ A;  3UN3 A;  1N2L A;  1FSU A;  1EI6 A;  1ALH A;  3UO0 A;  1P49 A;  3SZZ A;  3MK2 A;  3T00 A;  1ZED A;  4FDI A;  3M7V A;  3TWZ A;  1ELZ A;  3BDH A;  3BDG A;  1KH4 A;  1AJD A;  1B8J A;  1KHJ A;  1ED8 A;  3ED4 A;  3NVL A;  3SZY A;  1E1Z P;  3DYC A;  3M8W A;  3CMR A;  3T01 A;  1K7H A;  1ED9 A;  1O98 A;  1ZEB A;  3M8Z A;  1EW8 A;  1ANJ A;  1KH7 A;  1N2K A;  4FDJ A;  1Y6V A;  3BDF A;  1AJC A;  3OT9 A;  1ELY A;  1KH9 A;  1KHL A;  3UN5 A;  1ZEF A;  2G9Y A;  1E2S P;  1EJJ A;  3MK0 A;  1ANI A;  1E3C P;  1ALI A;  3MK1 A;  3T02 A;  1EW9 A;  3UN2 A;  3M8Y A;  1ALK A;  3DPC A;  1SHQ A;  3IGY B;  1ALJ A;  1SHN A;  2ANH A;  3TX0 A;  1AJB A;  1E33 P; 
#chains in the KnotProt database with same CATH topology
 1HDH A;  2IFY A;  1KH5 A;  1O99 A;  1KHN A;  1URA A;  2GA3 A;  1ELX A;  1AJA A;  3BDG B;  1EW2 A;  1Y7A A;  1HJK A;  1URB A;  1KHK A;  1AUK A;  2QZU A;  3UNY A;  1HQA A;  3IGZ B;  2GLQ A;  1EQJ A;  3UN3 A;  1N2L A;  1FSU A;  1EI6 A;  1ALH A;  3UO0 A;  1P49 A;  3SZZ A;  3MK2 A;  3T00 A;  1ZED A;  4FDI A;  3M7V A;  3TWZ A;  1ELZ A;  3BDH A;  3BDG A;  1KH4 A;  1AJD A;  1B8J A;  1KHJ A;  1ED8 A;  3ED4 A;  3NVL A;  3SZY A;  1E1Z P;  3DYC A;  3M8W A;  3CMR A;  3T01 A;  1K7H A;  1ED9 A;  1O98 A;  1ZEB A;  3M8Z A;  1EW8 A;  1ANJ A;  1KH7 A;  1N2K A;  4FDJ A;  1Y6V A;  3BDF A;  1AJC A;  3OT9 A;  1ELY A;  1KH9 A;  1KHL A;  3UN5 A;  1ZEF A;  2G9Y A;  1E2S P;  1EJJ A;  3MK0 A;  1ANI A;  1E3C P;  1ALI A;  3MK1 A;  3T02 A;  1EW9 A;  3UN2 A;  3M8Y A;  1ALK A;  3DPC A;  1SHQ A;  3IGY B;  1ALJ A;  1SHN A;  2ANH A;  3TX0 A;  1AJB A;  1E33 P; 
#chains in the KnotProt database with same CATH homology
 1HDH A;  2IFY A;  1KH5 A;  1O99 A;  1KHN A;  1URA A;  2GA3 A;  1ELX A;  1AJA A;  3BDG B;  1EW2 A;  1Y7A A;  1HJK A;  1URB A;  1KHK A;  1AUK A;  2QZU A;  3UNY A;  1HQA A;  3IGZ B;  2GLQ A;  1EQJ A;  3UN3 A;  1N2L A;  1FSU A;  1EI6 A;  1ALH A;  3UO0 A;  1P49 A;  3SZZ A;  3MK2 A;  3T00 A;  1ZED A;  4FDI A;  3M7V A;  3TWZ A;  1ELZ A;  3BDH A;  3BDG A;  1KH4 A;  1AJD A;  1B8J A;  1KHJ A;  1ED8 A;  3ED4 A;  3NVL A;  3SZY A;  1E1Z P;  3DYC A;  3M8W A;  3CMR A;  3T01 A;  1K7H A;  1ED9 A;  1O98 A;  1ZEB A;  3M8Z A;  1EW8 A;  1ANJ A;  1KH7 A;  1N2K A;  4FDJ A;  1Y6V A;  3BDF A;  1AJC A;  3OT9 A;  1ELY A;  1KH9 A;  1KHL A;  3UN5 A;  1ZEF A;  2G9Y A;  1E2S P;  1EJJ A;  3MK0 A;  1ANI A;  1E3C P;  1ALI A;  3MK1 A;  3T02 A;  1EW9 A;  3UN2 A;  3M8Y A;  1ALK A;  3DPC A;  1SHQ A;  3IGY B;  1ALJ A;  1SHN A;  2ANH A;  3TX0 A;  1AJB A;  1E33 P; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling