1E33P

Crystal structure of an arylsulfatase a mutant p426l
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 7-263 257 1-6 294-485 264-293 6 192 slipknot
Chain Sequence
RPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLXTPSRAALLTGRLPVRMGMYPGVLVPSSRGGLPLEEVTVAEVLAARGYLTGMAGKWHLGVGPEGAFLPPHQGFHRFLGIPYSHDQGPCQNLTCFPPATPCDGGCDQGLVPIPLLANLSVEAQPPWLPGLEARYMAFAHDLMADAQREDRPFFLYYASHHTHYPQFSGQSFAERSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIFTADNGPETMRMSRGGCSGLLRCGKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPLPNVTLDGFDLSPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSLTAHEPLLLYDLSKDPGENYNLLG----ATPEVLQALKQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 5-261 257 1-4 267-481 262-266 4 215 slipknot
view details
3.1 7-266 260 1-6 294-481 267-293 6 188 slipknot
view details
3.1 6-293 288 1-5 295-481 294-294 5 187 slipknot
view details
2.1 6-294 289 1-5 296-481 295-295 5 186 slipknot
sequence length 485
structure length 481
publication title Defective Oligomerization of Arylsulfatase a as a Cause of its Instability in Lysosomes and Metachromatic Leukodystrophy.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ARYLSULFATASE A
missing residues 426-429
total genus Genus: 153
ec nomenclature ec 3.1.6.8: Cerebroside-sulfatase.
pdb deposition date 2000-06-06
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.10 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 1e33P02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1e33P01
1AJDA 1EW9A 1URBA 3SZYA 3BDFA 2GLQA 3M8WA 1Y6VA 1HJKA 1E1ZP 1KHLA 2ANHA 3UN5A 1AJBA 1KHKA 3MK2A 1AUKA 1EW8A 3M7VA 4FDIA 3BDGA 2GA3A 3DYCA 3NVLA 1SHQA 3UN2A 4FDJA 3T00A 1E2SP 2IFYA 1EQJA 1Y7AA 3UO0A 1E3CP 3OT9A 3TWZA 3CMRA 1ELXA 1KH5A 1KHNA 3TX0A 1ED9A 3M8YA 1HQAA 1ZEBA 3SZZA 3UNYA 1ANJA 3MK0A 1HDHA 1ELZA 2G9YA 1EI6A 1N2KA 3IGYB 3DPCA 1N2LA 1B8JA 1E33P 2QZUA 1FSUA 1KH4A 1O98A 3T01A 1ED8A 1EW2A 1SHNA 1ELYA 1AJCA 3UN3A 1ALJA 1K7HA 3IGZB 3ED4A 1P49A 1URAA 1ANIA 1KHJA 3BDGB 3M8ZA 3MK1A 1AJAA 1ZEFA 3BDHA 1EJJA 3T02A 1ALIA 1ALKA 1ZEDA 1KH9A 1KH7A 1O99A
chains in the KnotProt database with same CATH superfamily
1AJDA 1EW9A 1URBA 3SZYA 3BDFA 2GLQA 3M8WA 1Y6VA 1HJKA 1E1ZP 1KHLA 2ANHA 3UN5A 1AJBA 1KHKA 3MK2A 1AUKA 1EW8A 3M7VA 4FDIA 3BDGA 2GA3A 3DYCA 3NVLA 1SHQA 3UN2A 4FDJA 3T00A 1E2SP 2IFYA 1EQJA 1Y7AA 3UO0A 1E3CP 3OT9A 3TWZA 3CMRA 1ELXA 1KH5A 1KHNA 3TX0A 1ED9A 3M8YA 1HQAA 1ZEBA 3SZZA 3UNYA 1ANJA 3MK0A 1HDHA 1ELZA 2G9YA 1EI6A 1N2KA 3IGYB 3DPCA 1N2LA 1B8JA 1E33P 2QZUA 1FSUA 1KH4A 1O98A 3T01A 1ED8A 1EW2A 1SHNA 1ELYA 1AJCA 3UN3A 1ALJA 1K7HA 3IGZB 3ED4A 1P49A 1URAA 1ANIA 1KHJA 3BDGB 3M8ZA 3MK1A 1AJAA 1ZEFA 3BDHA 1EJJA 3T02A 1ALIA 1ALKA 1ZEDA 1KH9A 1KH7A 1O99A
chains in the KnotProt database with same CATH topology
1AJDA 1EW9A 1URBA 3SZYA 3BDFA 2GLQA 3M8WA 1Y6VA 1HJKA 1E1ZP 1KHLA 2ANHA 3UN5A 1AJBA 1KHKA 3MK2A 1AUKA 1EW8A 3M7VA 4FDIA 3BDGA 2GA3A 3DYCA 3NVLA 1SHQA 3UN2A 4FDJA 3T00A 1E2SP 2IFYA 1EQJA 1Y7AA 3UO0A 1E3CP 3OT9A 3TWZA 3CMRA 1ELXA 1KH5A 1KHNA 3TX0A 1ED9A 3M8YA 1HQAA 1ZEBA 3SZZA 3UNYA 1ANJA 3MK0A 1HDHA 1ELZA 2G9YA 1EI6A 1N2KA 3IGYB 3DPCA 1N2LA 1B8JA 1E33P 2QZUA 1FSUA 1KH4A 1O98A 3T01A 1ED8A 1EW2A 1SHNA 1ELYA 1AJCA 3UN3A 1ALJA 1K7HA 3IGZB 3ED4A 1P49A 1URAA 1ANIA 1KHJA 3BDGB 3M8ZA 3MK1A 1AJAA 1ZEFA 3BDHA 1EJJA 3T02A 1ALIA 1ALKA 1ZEDA 1KH9A 1KH7A 1O99A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1AJD A;  1EW9 A;  1URB A;  3SZY A;  3BDF A;  2GLQ A;  3M8W A;  1Y6V A;  1HJK A;  1E1Z P;  1KHL A;  2ANH A;  3UN5 A;  1AJB A;  1KHK A;  3MK2 A;  1AUK A;  1EW8 A;  3M7V A;  4FDI A;  3BDG A;  2GA3 A;  3DYC A;  3NVL A;  1SHQ A;  3UN2 A;  4FDJ A;  3T00 A;  1E2S P;  2IFY A;  1EQJ A;  1Y7A A;  3UO0 A;  1E3C P;  3OT9 A;  3TWZ A;  3CMR A;  1ELX A;  1KH5 A;  1KHN A;  3TX0 A;  1ED9 A;  3M8Y A;  1HQA A;  1ZEB A;  3SZZ A;  3UNY A;  1ANJ A;  3MK0 A;  1HDH A;  1ELZ A;  2G9Y A;  1EI6 A;  1N2K A;  3IGY B;  3DPC A;  1N2L A;  1B8J A;  1E33 P;  2QZU A;  1FSU A;  1KH4 A;  1O98 A;  3T01 A;  1ED8 A;  1EW2 A;  1SHN A;  1ELY A;  1AJC A;  3UN3 A;  1ALJ A;  1K7H A;  3IGZ B;  3ED4 A;  1P49 A;  1URA A;  1ANI A;  1KHJ A;  3BDG B;  3M8Z A;  3MK1 A;  1AJA A;  1ZEF A;  3BDH A;  1EJJ A;  3T02 A;  1ALI A;  1ALK A;  1ZED A;  1KH9 A;  1KH7 A;  1O99 A; 
#chains in the KnotProt database with same CATH topology
 1AJD A;  1EW9 A;  1URB A;  3SZY A;  3BDF A;  2GLQ A;  3M8W A;  1Y6V A;  1HJK A;  1E1Z P;  1KHL A;  2ANH A;  3UN5 A;  1AJB A;  1KHK A;  3MK2 A;  1AUK A;  1EW8 A;  3M7V A;  4FDI A;  3BDG A;  2GA3 A;  3DYC A;  3NVL A;  1SHQ A;  3UN2 A;  4FDJ A;  3T00 A;  1E2S P;  2IFY A;  1EQJ A;  1Y7A A;  3UO0 A;  1E3C P;  3OT9 A;  3TWZ A;  3CMR A;  1ELX A;  1KH5 A;  1KHN A;  3TX0 A;  1ED9 A;  3M8Y A;  1HQA A;  1ZEB A;  3SZZ A;  3UNY A;  1ANJ A;  3MK0 A;  1HDH A;  1ELZ A;  2G9Y A;  1EI6 A;  1N2K A;  3IGY B;  3DPC A;  1N2L A;  1B8J A;  1E33 P;  2QZU A;  1FSU A;  1KH4 A;  1O98 A;  3T01 A;  1ED8 A;  1EW2 A;  1SHN A;  1ELY A;  1AJC A;  3UN3 A;  1ALJ A;  1K7H A;  3IGZ B;  3ED4 A;  1P49 A;  1URA A;  1ANI A;  1KHJ A;  3BDG B;  3M8Z A;  3MK1 A;  1AJA A;  1ZEF A;  3BDH A;  1EJJ A;  3T02 A;  1ALI A;  1ALK A;  1ZED A;  1KH9 A;  1KH7 A;  1O99 A; 
#chains in the KnotProt database with same CATH homology
 1AJD A;  1EW9 A;  1URB A;  3SZY A;  3BDF A;  2GLQ A;  3M8W A;  1Y6V A;  1HJK A;  1E1Z P;  1KHL A;  2ANH A;  3UN5 A;  1AJB A;  1KHK A;  3MK2 A;  1AUK A;  1EW8 A;  3M7V A;  4FDI A;  3BDG A;  2GA3 A;  3DYC A;  3NVL A;  1SHQ A;  3UN2 A;  4FDJ A;  3T00 A;  1E2S P;  2IFY A;  1EQJ A;  1Y7A A;  3UO0 A;  1E3C P;  3OT9 A;  3TWZ A;  3CMR A;  1ELX A;  1KH5 A;  1KHN A;  3TX0 A;  1ED9 A;  3M8Y A;  1HQA A;  1ZEB A;  3SZZ A;  3UNY A;  1ANJ A;  3MK0 A;  1HDH A;  1ELZ A;  2G9Y A;  1EI6 A;  1N2K A;  3IGY B;  3DPC A;  1N2L A;  1B8J A;  1E33 P;  2QZU A;  1FSU A;  1KH4 A;  1O98 A;  3T01 A;  1ED8 A;  1EW2 A;  1SHN A;  1ELY A;  1AJC A;  3UN3 A;  1ALJ A;  1K7H A;  3IGZ B;  3ED4 A;  1P49 A;  1URA A;  1ANI A;  1KHJ A;  3BDG B;  3M8Z A;  3MK1 A;  1AJA A;  1ZEF A;  3BDH A;  1EJJ A;  3T02 A;  1ALI A;  1ALK A;  1ZED A;  1KH9 A;  1KH7 A;  1O99 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling