4FDJA

The molecular basis of mucopolysaccharidosis iv a, complex with galnac
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 7-261 255 1-6 294-493 262-293 6 200 slipknot
Chain Sequence
PQPPNILLLLMDDMGWGDLGVYGEPSRETPNLDRMAAEGLLFPNFYSANPLXSPSRAALLTGRLPIRNGFYTTNAHARNAYTPQEIVGGIPDSEQLLPELLKKAGYVSKIVGKWHLGHRPQFHPLKHGFDEWFGSPNCHFGPYDNKARPNIPVYRDWEMVGRYYEEFPINLKTGEANLTQIYLQEALDFIKRQARHHPFFLYWAVDATHAPVYASKPFLGTSQRGRYGDAVREIDDSIGKILELLQDLHVADNTFVFFTSDNGAALISAPEQGGSNGPFLCGKQTTFEGGMREPALAWWPGHVTAGQVSHQLGSIMDLFTTSLALAGLTPPSDRAIDGLNLLPTLLQGRLMDRPIFYYRGDTLMAATLGQHKAHFWTWTNSWENFRQGIDFCPGQNVSGVTTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCNWAVMNWAPPGCEKLGKCLTPPESIPKKCLW
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 7-264 258 1-6 277-493 265-276 6 217 slipknot
view details
3.1 6-277 272 1-5 291-493 278-290 5 203 slipknot
view details
2.1 6-290 285 1-5 296-493 291-295 5 198 slipknot
view details
3.1 9-285 277 1-5, 292-493 6-8, 286-291 5 202 slipknot
sequence length 493
structure length 493
publication title The Structure of Human GALNS Reveals the Molecular Basis for Mucopolysaccharidosis IV A.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords N-acetylgalactosamine-6-sulfatase
source organism Homo sapiens
total genus Genus: 171
ec nomenclature ec 3.1.6.4: N-acetylgalactosamine-6-sulfatase.
pdb deposition date 2012-05-28
KnotProt deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.10 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4fdjA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4fdjA01
1ELYA 1ALKA 2GLQA 1SHQA 3M8YA 3BDGB 1EW9A 2IFYA 1AJDA 1ED9A 1ZEFA 3UN5A 1ALIA 3T01A 1ED8A 1ANJA 3UNYA 2ANHA 3BDFA 1KH9A 1ZEBA 1EW2A 3T02A 1HQAA 3TWZA 1P49A 3MK0A 1EJJA 1FSUA 1KH5A 3IGYB 1Y6VA 1B8JA 1ELXA 1AJAA 1AJCA 3SZZA 1E2SP 3IGZB 1HJKA 1O99A 3BDGA 3TX0A 1ELZA 2G9YA 1E1ZP 2QZUA 1N2LA 1HDHA 1URAA 1SHNA 3DPCA 1EW8A 4FDIA 3DYCA 3NVLA 3ED4A 3MK1A 3UN2A 3SZYA 3CMRA 1ANIA 1E3CP 1ZEDA 3M7VA 3BDHA 3OT9A 1Y7AA 1AUKA 1KH7A 1EI6A 1KHLA 3T00A 1N2KA 1KHJA 4FDJA 1AJBA 3M8WA 1ALJA 3UN3A 2GA3A 1K7HA 1URBA 1EQJA 1KHKA 3UO0A 1O98A 3M8ZA 3MK2A 1KHNA 1KH4A 1E33P
chains in the KnotProt database with same CATH superfamily
1ELYA 1ALKA 2GLQA 1SHQA 3M8YA 3BDGB 1EW9A 2IFYA 1AJDA 1ED9A 1ZEFA 3UN5A 1ALIA 3T01A 1ED8A 1ANJA 3UNYA 2ANHA 3BDFA 1KH9A 1ZEBA 1EW2A 3T02A 1HQAA 3TWZA 1P49A 3MK0A 1EJJA 1FSUA 1KH5A 3IGYB 1Y6VA 1B8JA 1ELXA 1AJAA 1AJCA 3SZZA 1E2SP 3IGZB 1HJKA 1O99A 3BDGA 3TX0A 1ELZA 2G9YA 1E1ZP 2QZUA 1N2LA 1HDHA 1URAA 1SHNA 3DPCA 1EW8A 4FDIA 3DYCA 3NVLA 3ED4A 3MK1A 3UN2A 3SZYA 3CMRA 1ANIA 1E3CP 1ZEDA 3M7VA 3BDHA 3OT9A 1Y7AA 1AUKA 1KH7A 1EI6A 1KHLA 3T00A 1N2KA 1KHJA 4FDJA 1AJBA 3M8WA 1ALJA 3UN3A 2GA3A 1K7HA 1URBA 1EQJA 1KHKA 3UO0A 1O98A 3M8ZA 3MK2A 1KHNA 1KH4A 1E33P
chains in the KnotProt database with same CATH topology
1ELYA 1ALKA 2GLQA 1SHQA 3M8YA 3BDGB 1EW9A 2IFYA 1AJDA 1ED9A 1ZEFA 3UN5A 1ALIA 3T01A 1ED8A 1ANJA 3UNYA 2ANHA 3BDFA 1KH9A 1ZEBA 1EW2A 3T02A 1HQAA 3TWZA 1P49A 3MK0A 1EJJA 1FSUA 1KH5A 3IGYB 1Y6VA 1B8JA 1ELXA 1AJAA 1AJCA 3SZZA 1E2SP 3IGZB 1HJKA 1O99A 3BDGA 3TX0A 1ELZA 2G9YA 1E1ZP 2QZUA 1N2LA 1HDHA 1URAA 1SHNA 3DPCA 1EW8A 4FDIA 3DYCA 3NVLA 3ED4A 3MK1A 3UN2A 3SZYA 3CMRA 1ANIA 1E3CP 1ZEDA 3M7VA 3BDHA 3OT9A 1Y7AA 1AUKA 1KH7A 1EI6A 1KHLA 3T00A 1N2KA 1KHJA 4FDJA 1AJBA 3M8WA 1ALJA 3UN3A 2GA3A 1K7HA 1URBA 1EQJA 1KHKA 3UO0A 1O98A 3M8ZA 3MK2A 1KHNA 1KH4A 1E33P
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1ELY A;  1ALK A;  2GLQ A;  1SHQ A;  3M8Y A;  3BDG B;  1EW9 A;  2IFY A;  1AJD A;  1ED9 A;  1ZEF A;  3UN5 A;  1ALI A;  3T01 A;  1ED8 A;  1ANJ A;  3UNY A;  2ANH A;  3BDF A;  1KH9 A;  1ZEB A;  1EW2 A;  3T02 A;  1HQA A;  3TWZ A;  1P49 A;  3MK0 A;  1EJJ A;  1FSU A;  1KH5 A;  3IGY B;  1Y6V A;  1B8J A;  1ELX A;  1AJA A;  1AJC A;  3SZZ A;  1E2S P;  3IGZ B;  1HJK A;  1O99 A;  3BDG A;  3TX0 A;  1ELZ A;  2G9Y A;  1E1Z P;  2QZU A;  1N2L A;  1HDH A;  1URA A;  1SHN A;  3DPC A;  1EW8 A;  4FDI A;  3DYC A;  3NVL A;  3ED4 A;  3MK1 A;  3UN2 A;  3SZY A;  3CMR A;  1ANI A;  1E3C P;  1ZED A;  3M7V A;  3BDH A;  3OT9 A;  1Y7A A;  1AUK A;  1KH7 A;  1EI6 A;  1KHL A;  3T00 A;  1N2K A;  1KHJ A;  4FDJ A;  1AJB A;  3M8W A;  1ALJ A;  3UN3 A;  2GA3 A;  1K7H A;  1URB A;  1EQJ A;  1KHK A;  3UO0 A;  1O98 A;  3M8Z A;  3MK2 A;  1KHN A;  1KH4 A;  1E33 P; 
#chains in the KnotProt database with same CATH topology
 1ELY A;  1ALK A;  2GLQ A;  1SHQ A;  3M8Y A;  3BDG B;  1EW9 A;  2IFY A;  1AJD A;  1ED9 A;  1ZEF A;  3UN5 A;  1ALI A;  3T01 A;  1ED8 A;  1ANJ A;  3UNY A;  2ANH A;  3BDF A;  1KH9 A;  1ZEB A;  1EW2 A;  3T02 A;  1HQA A;  3TWZ A;  1P49 A;  3MK0 A;  1EJJ A;  1FSU A;  1KH5 A;  3IGY B;  1Y6V A;  1B8J A;  1ELX A;  1AJA A;  1AJC A;  3SZZ A;  1E2S P;  3IGZ B;  1HJK A;  1O99 A;  3BDG A;  3TX0 A;  1ELZ A;  2G9Y A;  1E1Z P;  2QZU A;  1N2L A;  1HDH A;  1URA A;  1SHN A;  3DPC A;  1EW8 A;  4FDI A;  3DYC A;  3NVL A;  3ED4 A;  3MK1 A;  3UN2 A;  3SZY A;  3CMR A;  1ANI A;  1E3C P;  1ZED A;  3M7V A;  3BDH A;  3OT9 A;  1Y7A A;  1AUK A;  1KH7 A;  1EI6 A;  1KHL A;  3T00 A;  1N2K A;  1KHJ A;  4FDJ A;  1AJB A;  3M8W A;  1ALJ A;  3UN3 A;  2GA3 A;  1K7H A;  1URB A;  1EQJ A;  1KHK A;  3UO0 A;  1O98 A;  3M8Z A;  3MK2 A;  1KHN A;  1KH4 A;  1E33 P; 
#chains in the KnotProt database with same CATH homology
 1ELY A;  1ALK A;  2GLQ A;  1SHQ A;  3M8Y A;  3BDG B;  1EW9 A;  2IFY A;  1AJD A;  1ED9 A;  1ZEF A;  3UN5 A;  1ALI A;  3T01 A;  1ED8 A;  1ANJ A;  3UNY A;  2ANH A;  3BDF A;  1KH9 A;  1ZEB A;  1EW2 A;  3T02 A;  1HQA A;  3TWZ A;  1P49 A;  3MK0 A;  1EJJ A;  1FSU A;  1KH5 A;  3IGY B;  1Y6V A;  1B8J A;  1ELX A;  1AJA A;  1AJC A;  3SZZ A;  1E2S P;  3IGZ B;  1HJK A;  1O99 A;  3BDG A;  3TX0 A;  1ELZ A;  2G9Y A;  1E1Z P;  2QZU A;  1N2L A;  1HDH A;  1URA A;  1SHN A;  3DPC A;  1EW8 A;  4FDI A;  3DYC A;  3NVL A;  3ED4 A;  3MK1 A;  3UN2 A;  3SZY A;  3CMR A;  1ANI A;  1E3C P;  1ZED A;  3M7V A;  3BDH A;  3OT9 A;  1Y7A A;  1AUK A;  1KH7 A;  1EI6 A;  1KHL A;  3T00 A;  1N2K A;  1KHJ A;  4FDJ A;  1AJB A;  3M8W A;  1ALJ A;  3UN3 A;  2GA3 A;  1K7H A;  1URB A;  1EQJ A;  1KHK A;  3UO0 A;  1O98 A;  3M8Z A;  3MK2 A;  1KHN A;  1KH4 A;  1E33 P; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling