4FDIA

The molecular basis of mucopolysaccharidosis iv a
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 6-261 256 1-5 293-494 262-292 5 202 slipknot
Chain Sequence
QPPNILLLLMDDMGWGDLGVYGEPSRETPNLDRMAAEGLLFPNFYSANPLXSPSRAALLTGRLPIRNGFYTTNAHARNAYTPQEIVGGIPDSEQLLPELLKKAGYVSKIVGKWHLGHRPQFHPLKHGFDEWFGSPNCHFGPYDNKARPNIPVYRDWEMVGRYYEEFPINLKTGEANLTQIYLQEALDFIKRQARHHPFFLYWAVDATHAPVYASKPFLGTSQRGRYGDAVREIDDSIGKILELLQDLHVADNTFVFFTSDNGAALISAPEQGGSNGPFLCGKQTTFEGGMREPALAWWPGHVTAGQVSHQLGSIMDLFTTSLALAGLTPPSDRAIDGLNLLPTLLQGRLMDRPIFYYRGDTLMAATLGQHKAHFWTWTNSWENFRQGIDFCPGQNVSGVTTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCNWAVMNWAPPGCEKLGKCLTPPESIPKKCLWSH
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 5-261 257 1-4 271-494 262-270 4 224 slipknot
view details
3.1 5-271 267 1-4 282-494 272-281 4 213 slipknot
view details
3.1 5-283 279 1-4 291-494 284-290 4 204 slipknot
view details
2.1 9-282 274 1-3, 290-494 4-8, 283-289 3 205 slipknot
view details
2.1 9-289 281 1-3, 292-494 4-8, 290-291 3 203 slipknot
sequence length 494
structure length 494
publication title The Structure of Human GALNS Reveals the Molecular Basis for Mucopolysaccharidosis IV A.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords N-acetylgalactosamine-6-sulfatase
source organism Homo sapiens
total genus Genus: 175
ec nomenclature ec 3.1.6.4: N-acetylgalactosamine-6-sulfatase.
pdb deposition date 2012-05-28
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.10 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4fdiA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4fdiA01
3MK0A 1EJJA 4FDJA 1KH4A 2QZUA 1Y6VA 3OT9A 1URBA 3NVLA 3ED4A 1ED9A 1ELZA 1Y7AA 3UN5A 3UN2A 3CMRA 1KHJA 1EQJA 1KH9A 1ZEDA 3MK2A 3IGYB 1E1ZP 3DYCA 1ELYA 1EW2A 3SZZA 3M8YA 1O99A 1KH7A 4FDIA 1HJKA 1O98A 1ALHA 1KHKA 1B8JA 3UO0A 2GA3A 3BDFA 3M8WA 1EW8A 1N2LA 3DPCA 1AJBA 1ANJA 3T00A 1ALKA 1ALIA 1EW9A 1E2SP 2G9YA 3UN3A 3TWZA 1KHNA 2ANHA 1KH5A 3BDHA 1ALJA 1E33P 1AJDA 3TX0A 1HDHA 1KHLA 3M8ZA 3UNYA 1P49A 3T01A 3BDGA 2IFYA 3M7VA 1E3CP 2GLQA 1ELXA 3IGZB 1ED8A 1AJCA 1SHNA 1N2KA 3MK1A 1EI6A 1ZEFA 1AJAA 1SHQA 3BDGB 3SZYA 1AUKA 1FSUA 1K7HA 1ANIA 1HQAA 1URAA 1ZEBA 3T02A
chains in the KnotProt database with same CATH superfamily
3MK0A 1EJJA 4FDJA 1KH4A 2QZUA 1Y6VA 3OT9A 1URBA 3NVLA 3ED4A 1ED9A 1ELZA 1Y7AA 3UN5A 3UN2A 3CMRA 1KHJA 1EQJA 1KH9A 1ZEDA 3MK2A 3IGYB 1E1ZP 3DYCA 1ELYA 1EW2A 3SZZA 3M8YA 1O99A 1KH7A 4FDIA 1HJKA 1O98A 1ALHA 1KHKA 1B8JA 3UO0A 2GA3A 3BDFA 3M8WA 1EW8A 1N2LA 3DPCA 1AJBA 1ANJA 3T00A 1ALKA 1ALIA 1EW9A 1E2SP 2G9YA 3UN3A 3TWZA 1KHNA 2ANHA 1KH5A 3BDHA 1ALJA 1E33P 1AJDA 3TX0A 1HDHA 1KHLA 3M8ZA 3UNYA 1P49A 3T01A 3BDGA 2IFYA 3M7VA 1E3CP 2GLQA 1ELXA 3IGZB 1ED8A 1AJCA 1SHNA 1N2KA 3MK1A 1EI6A 1ZEFA 1AJAA 1SHQA 3BDGB 3SZYA 1AUKA 1FSUA 1K7HA 1ANIA 1HQAA 1URAA 1ZEBA 3T02A
chains in the KnotProt database with same CATH topology
3MK0A 1EJJA 4FDJA 1KH4A 2QZUA 1Y6VA 3OT9A 1URBA 3NVLA 3ED4A 1ED9A 1ELZA 1Y7AA 3UN5A 3UN2A 3CMRA 1KHJA 1EQJA 1KH9A 1ZEDA 3MK2A 3IGYB 1E1ZP 3DYCA 1ELYA 1EW2A 3SZZA 3M8YA 1O99A 1KH7A 4FDIA 1HJKA 1O98A 1ALHA 1KHKA 1B8JA 3UO0A 2GA3A 3BDFA 3M8WA 1EW8A 1N2LA 3DPCA 1AJBA 1ANJA 3T00A 1ALKA 1ALIA 1EW9A 1E2SP 2G9YA 3UN3A 3TWZA 1KHNA 2ANHA 1KH5A 3BDHA 1ALJA 1E33P 1AJDA 3TX0A 1HDHA 1KHLA 3M8ZA 3UNYA 1P49A 3T01A 3BDGA 2IFYA 3M7VA 1E3CP 2GLQA 1ELXA 3IGZB 1ED8A 1AJCA 1SHNA 1N2KA 3MK1A 1EI6A 1ZEFA 1AJAA 1SHQA 3BDGB 3SZYA 1AUKA 1FSUA 1K7HA 1ANIA 1HQAA 1URAA 1ZEBA 3T02A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3MK0 A;  1EJJ A;  4FDJ A;  1KH4 A;  2QZU A;  1Y6V A;  3OT9 A;  1URB A;  3NVL A;  3ED4 A;  1ED9 A;  1ELZ A;  1Y7A A;  3UN5 A;  3UN2 A;  3CMR A;  1KHJ A;  1EQJ A;  1KH9 A;  1ZED A;  3MK2 A;  3IGY B;  1E1Z P;  3DYC A;  1ELY A;  1EW2 A;  3SZZ A;  3M8Y A;  1O99 A;  1KH7 A;  4FDI A;  1HJK A;  1O98 A;  1ALH A;  1KHK A;  1B8J A;  3UO0 A;  2GA3 A;  3BDF A;  3M8W A;  1EW8 A;  1N2L A;  3DPC A;  1AJB A;  1ANJ A;  3T00 A;  1ALK A;  1ALI A;  1EW9 A;  1E2S P;  2G9Y A;  3UN3 A;  3TWZ A;  1KHN A;  2ANH A;  1KH5 A;  3BDH A;  1ALJ A;  1E33 P;  1AJD A;  3TX0 A;  1HDH A;  1KHL A;  3M8Z A;  3UNY A;  1P49 A;  3T01 A;  3BDG A;  2IFY A;  3M7V A;  1E3C P;  2GLQ A;  1ELX A;  3IGZ B;  1ED8 A;  1AJC A;  1SHN A;  1N2K A;  3MK1 A;  1EI6 A;  1ZEF A;  1AJA A;  1SHQ A;  3BDG B;  3SZY A;  1AUK A;  1FSU A;  1K7H A;  1ANI A;  1HQA A;  1URA A;  1ZEB A;  3T02 A; 
#chains in the KnotProt database with same CATH topology
 3MK0 A;  1EJJ A;  4FDJ A;  1KH4 A;  2QZU A;  1Y6V A;  3OT9 A;  1URB A;  3NVL A;  3ED4 A;  1ED9 A;  1ELZ A;  1Y7A A;  3UN5 A;  3UN2 A;  3CMR A;  1KHJ A;  1EQJ A;  1KH9 A;  1ZED A;  3MK2 A;  3IGY B;  1E1Z P;  3DYC A;  1ELY A;  1EW2 A;  3SZZ A;  3M8Y A;  1O99 A;  1KH7 A;  4FDI A;  1HJK A;  1O98 A;  1ALH A;  1KHK A;  1B8J A;  3UO0 A;  2GA3 A;  3BDF A;  3M8W A;  1EW8 A;  1N2L A;  3DPC A;  1AJB A;  1ANJ A;  3T00 A;  1ALK A;  1ALI A;  1EW9 A;  1E2S P;  2G9Y A;  3UN3 A;  3TWZ A;  1KHN A;  2ANH A;  1KH5 A;  3BDH A;  1ALJ A;  1E33 P;  1AJD A;  3TX0 A;  1HDH A;  1KHL A;  3M8Z A;  3UNY A;  1P49 A;  3T01 A;  3BDG A;  2IFY A;  3M7V A;  1E3C P;  2GLQ A;  1ELX A;  3IGZ B;  1ED8 A;  1AJC A;  1SHN A;  1N2K A;  3MK1 A;  1EI6 A;  1ZEF A;  1AJA A;  1SHQ A;  3BDG B;  3SZY A;  1AUK A;  1FSU A;  1K7H A;  1ANI A;  1HQA A;  1URA A;  1ZEB A;  3T02 A; 
#chains in the KnotProt database with same CATH homology
 3MK0 A;  1EJJ A;  4FDJ A;  1KH4 A;  2QZU A;  1Y6V A;  3OT9 A;  1URB A;  3NVL A;  3ED4 A;  1ED9 A;  1ELZ A;  1Y7A A;  3UN5 A;  3UN2 A;  3CMR A;  1KHJ A;  1EQJ A;  1KH9 A;  1ZED A;  3MK2 A;  3IGY B;  1E1Z P;  3DYC A;  1ELY A;  1EW2 A;  3SZZ A;  3M8Y A;  1O99 A;  1KH7 A;  4FDI A;  1HJK A;  1O98 A;  1ALH A;  1KHK A;  1B8J A;  3UO0 A;  2GA3 A;  3BDF A;  3M8W A;  1EW8 A;  1N2L A;  3DPC A;  1AJB A;  1ANJ A;  3T00 A;  1ALK A;  1ALI A;  1EW9 A;  1E2S P;  2G9Y A;  3UN3 A;  3TWZ A;  1KHN A;  2ANH A;  1KH5 A;  3BDH A;  1ALJ A;  1E33 P;  1AJD A;  3TX0 A;  1HDH A;  1KHL A;  3M8Z A;  3UNY A;  1P49 A;  3T01 A;  3BDG A;  2IFY A;  3M7V A;  1E3C P;  2GLQ A;  1ELX A;  3IGZ B;  1ED8 A;  1AJC A;  1SHN A;  1N2K A;  3MK1 A;  1EI6 A;  1ZEF A;  1AJA A;  1SHQ A;  3BDG B;  3SZY A;  1AUK A;  1FSU A;  1K7H A;  1ANI A;  1HQA A;  1URA A;  1ZEB A;  3T02 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling