4FDIA

The molecular basis of mucopolysaccharidosis iv a
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 6-261 256 1-5 293-494 262-292 5 202 slipknot
Chain Sequence
QPPNILLLLMDDMGWGDLGVYGEPSRETPNLDRMAAEGLLFPNFYSANPLXSPSRAALLTGRLPIRNGFYTTNAHARNAYTPQEIVGGIPDSEQLLPELLKKAGYVSKIVGKWHLGHRPQFHPLKHGFDEWFGSPNCHFGPYDNKARPNIPVYRDWEMVGRYYEEFPINLKTGEANLTQIYLQEALDFIKRQARHHPFFLYWAVDATHAPVYASKPFLGTSQRGRYGDAVREIDDSIGKILELLQDLHVADNTFVFFTSDNGAALISAPEQGGSNGPFLCGKQTTFEGGMREPALAWWPGHVTAGQVSHQLGSIMDLFTTSLALAGLTPPSDRAIDGLNLLPTLLQGRLMDRPIFYYRGDTLMAATLGQHKAHFWTWTNSWENFRQGIDFCPGQNVSGVTTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCNWAVMNWAPPGCEKLGKCLTPPESIPKKCLWSH
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 5-261 257 1-4 271-494 262-270 4 224 slipknot
view details
3.1 5-271 267 1-4 282-494 272-281 4 213 slipknot
view details
3.1 5-283 279 1-4 291-494 284-290 4 204 slipknot
view details
2.1 9-282 274 1-3, 290-494 4-8, 283-289 3 205 slipknot
view details
2.1 9-289 281 1-3, 292-494 4-8, 290-291 3 203 slipknot
sequence length 494
structure length 494
publication title The Structure of Human GALNS Reveals the Molecular Basis for Mucopolysaccharidosis IV A.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords N-acetylgalactosamine-6-sulfatase
source organism Homo sapiens
total genus Genus: 175
ec nomenclature ec 3.1.6.4: N-acetylgalactosamine-6-sulfatase.
pdb deposition date 2012-05-28
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.10 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4fdiA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4fdiA01
3UN3A 3IGZB 1AUKA 1P49A 1EW2A 3TWZA 1FSUA 3T02A 3UN5A 1ED8A 1EI6A 1E3CP 1ALJA 1B8JA 1ELZA 1ALIA 1KHNA 3IGYB 1AJDA 1AJAA 1O99A 1E2SP 3UO0A 1N2LA 1Y7AA 1EQJA 1EW9A 3MK2A 1AJBA 4FDIA 3SZYA 1ZEDA 3M8YA 1SHNA 1E1ZP 3T01A 1HDHA 3DYCA 1ALHA 2ANHA 1KHJA 3ED4A 3OT9A 2QZUA 2IFYA 2GLQA 1ED9A 1ELXA 1KHKA 3NVLA 3UNYA 1KHLA 3UN2A 1ANJA 1KH4A 1Y6VA 1ZEBA 1URAA 3M8WA 1HJKA 1ELYA 1KH9A 3CMRA 1HQAA 1KH5A 1SHQA 3T00A 1EJJA 3SZZA 3M8ZA 1URBA 3M7VA 3MK1A 3TX0A 1ZEFA 3BDHA 3MK0A 1ALKA 3BDGB 4FDJA 1E33P 1K7HA 2G9YA 1ANIA 3BDGA 1N2KA 1EW8A 3BDFA 1KH7A 2GA3A 3DPCA 1O98A 1AJCA
chains in the KnotProt database with same CATH superfamily
3UN3A 3IGZB 1AUKA 1P49A 1EW2A 3TWZA 1FSUA 3T02A 3UN5A 1ED8A 1EI6A 1E3CP 1ALJA 1B8JA 1ELZA 1ALIA 1KHNA 3IGYB 1AJDA 1AJAA 1O99A 1E2SP 3UO0A 1N2LA 1Y7AA 1EQJA 1EW9A 3MK2A 1AJBA 4FDIA 3SZYA 1ZEDA 3M8YA 1SHNA 1E1ZP 3T01A 1HDHA 3DYCA 1ALHA 2ANHA 1KHJA 3ED4A 3OT9A 2QZUA 2IFYA 2GLQA 1ED9A 1ELXA 1KHKA 3NVLA 3UNYA 1KHLA 3UN2A 1ANJA 1KH4A 1Y6VA 1ZEBA 1URAA 3M8WA 1HJKA 1ELYA 1KH9A 3CMRA 1HQAA 1KH5A 1SHQA 3T00A 1EJJA 3SZZA 3M8ZA 1URBA 3M7VA 3MK1A 3TX0A 1ZEFA 3BDHA 3MK0A 1ALKA 3BDGB 4FDJA 1E33P 1K7HA 2G9YA 1ANIA 3BDGA 1N2KA 1EW8A 3BDFA 1KH7A 2GA3A 3DPCA 1O98A 1AJCA
chains in the KnotProt database with same CATH topology
3UN3A 3IGZB 1AUKA 1P49A 1EW2A 3TWZA 1FSUA 3T02A 3UN5A 1ED8A 1EI6A 1E3CP 1ALJA 1B8JA 1ELZA 1ALIA 1KHNA 3IGYB 1AJDA 1AJAA 1O99A 1E2SP 3UO0A 1N2LA 1Y7AA 1EQJA 1EW9A 3MK2A 1AJBA 4FDIA 3SZYA 1ZEDA 3M8YA 1SHNA 1E1ZP 3T01A 1HDHA 3DYCA 1ALHA 2ANHA 1KHJA 3ED4A 3OT9A 2QZUA 2IFYA 2GLQA 1ED9A 1ELXA 1KHKA 3NVLA 3UNYA 1KHLA 3UN2A 1ANJA 1KH4A 1Y6VA 1ZEBA 1URAA 3M8WA 1HJKA 1ELYA 1KH9A 3CMRA 1HQAA 1KH5A 1SHQA 3T00A 1EJJA 3SZZA 3M8ZA 1URBA 3M7VA 3MK1A 3TX0A 1ZEFA 3BDHA 3MK0A 1ALKA 3BDGB 4FDJA 1E33P 1K7HA 2G9YA 1ANIA 3BDGA 1N2KA 1EW8A 3BDFA 1KH7A 2GA3A 3DPCA 1O98A 1AJCA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3UN3 A;  3IGZ B;  1AUK A;  1P49 A;  1EW2 A;  3TWZ A;  1FSU A;  3T02 A;  3UN5 A;  1ED8 A;  1EI6 A;  1E3C P;  1ALJ A;  1B8J A;  1ELZ A;  1ALI A;  1KHN A;  3IGY B;  1AJD A;  1AJA A;  1O99 A;  1E2S P;  3UO0 A;  1N2L A;  1Y7A A;  1EQJ A;  1EW9 A;  3MK2 A;  1AJB A;  4FDI A;  3SZY A;  1ZED A;  3M8Y A;  1SHN A;  1E1Z P;  3T01 A;  1HDH A;  3DYC A;  1ALH A;  2ANH A;  1KHJ A;  3ED4 A;  3OT9 A;  2QZU A;  2IFY A;  2GLQ A;  1ED9 A;  1ELX A;  1KHK A;  3NVL A;  3UNY A;  1KHL A;  3UN2 A;  1ANJ A;  1KH4 A;  1Y6V A;  1ZEB A;  1URA A;  3M8W A;  1HJK A;  1ELY A;  1KH9 A;  3CMR A;  1HQA A;  1KH5 A;  1SHQ A;  3T00 A;  1EJJ A;  3SZZ A;  3M8Z A;  1URB A;  3M7V A;  3MK1 A;  3TX0 A;  1ZEF A;  3BDH A;  3MK0 A;  1ALK A;  3BDG B;  4FDJ A;  1E33 P;  1K7H A;  2G9Y A;  1ANI A;  3BDG A;  1N2K A;  1EW8 A;  3BDF A;  1KH7 A;  2GA3 A;  3DPC A;  1O98 A;  1AJC A; 
#chains in the KnotProt database with same CATH topology
 3UN3 A;  3IGZ B;  1AUK A;  1P49 A;  1EW2 A;  3TWZ A;  1FSU A;  3T02 A;  3UN5 A;  1ED8 A;  1EI6 A;  1E3C P;  1ALJ A;  1B8J A;  1ELZ A;  1ALI A;  1KHN A;  3IGY B;  1AJD A;  1AJA A;  1O99 A;  1E2S P;  3UO0 A;  1N2L A;  1Y7A A;  1EQJ A;  1EW9 A;  3MK2 A;  1AJB A;  4FDI A;  3SZY A;  1ZED A;  3M8Y A;  1SHN A;  1E1Z P;  3T01 A;  1HDH A;  3DYC A;  1ALH A;  2ANH A;  1KHJ A;  3ED4 A;  3OT9 A;  2QZU A;  2IFY A;  2GLQ A;  1ED9 A;  1ELX A;  1KHK A;  3NVL A;  3UNY A;  1KHL A;  3UN2 A;  1ANJ A;  1KH4 A;  1Y6V A;  1ZEB A;  1URA A;  3M8W A;  1HJK A;  1ELY A;  1KH9 A;  3CMR A;  1HQA A;  1KH5 A;  1SHQ A;  3T00 A;  1EJJ A;  3SZZ A;  3M8Z A;  1URB A;  3M7V A;  3MK1 A;  3TX0 A;  1ZEF A;  3BDH A;  3MK0 A;  1ALK A;  3BDG B;  4FDJ A;  1E33 P;  1K7H A;  2G9Y A;  1ANI A;  3BDG A;  1N2K A;  1EW8 A;  3BDF A;  1KH7 A;  2GA3 A;  3DPC A;  1O98 A;  1AJC A; 
#chains in the KnotProt database with same CATH homology
 3UN3 A;  3IGZ B;  1AUK A;  1P49 A;  1EW2 A;  3TWZ A;  1FSU A;  3T02 A;  3UN5 A;  1ED8 A;  1EI6 A;  1E3C P;  1ALJ A;  1B8J A;  1ELZ A;  1ALI A;  1KHN A;  3IGY B;  1AJD A;  1AJA A;  1O99 A;  1E2S P;  3UO0 A;  1N2L A;  1Y7A A;  1EQJ A;  1EW9 A;  3MK2 A;  1AJB A;  4FDI A;  3SZY A;  1ZED A;  3M8Y A;  1SHN A;  1E1Z P;  3T01 A;  1HDH A;  3DYC A;  1ALH A;  2ANH A;  1KHJ A;  3ED4 A;  3OT9 A;  2QZU A;  2IFY A;  2GLQ A;  1ED9 A;  1ELX A;  1KHK A;  3NVL A;  3UNY A;  1KHL A;  3UN2 A;  1ANJ A;  1KH4 A;  1Y6V A;  1ZEB A;  1URA A;  3M8W A;  1HJK A;  1ELY A;  1KH9 A;  3CMR A;  1HQA A;  1KH5 A;  1SHQ A;  3T00 A;  1EJJ A;  3SZZ A;  3M8Z A;  1URB A;  3M7V A;  3MK1 A;  3TX0 A;  1ZEF A;  3BDH A;  3MK0 A;  1ALK A;  3BDG B;  4FDJ A;  1E33 P;  1K7H A;  2G9Y A;  1ANI A;  3BDG A;  1N2K A;  1EW8 A;  3BDF A;  1KH7 A;  2GA3 A;  3DPC A;  1O98 A;  1AJC A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling