1EI6A

Crystal structure of phosphonoacetate hydrolase complexed with phosphonoformate
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 24-240 217 1-23 376-406 241-375 23 31 slipknot
Chain Sequence
TNLISVNSRSYRLSSAPTIVICVDGCEQEYINQAIQAGQAPFLAELTGFGTVLTGDCVVPSFTNPNNLSIVTGAPPSVHGICGNFFFDQETQEEVLMNDAKYLRAPTILAEMAKAGQLVAVVTAKDKLRNLLGHQLKGICFSAEKADQVNLEEHGVENILARVGMPVPSVYSADLSEFVFAAGLSLLTNERPDFMYLSTTDYVQHKHAPGTPEANAFYAMMDSYFKRYHEQGAIVAITADHGMNAKTDAIGRPNILFLQDLLDAQYGAQRTRVLLPITDPYVVHHGALGSYATVYLRDAVPQRDAIDFLAGIAGVEAVLTRSQACQRFELPEDRIGDLVVLGERLTVLGSAADKHDLSGLTVPLRSHGGVSEQKVPLIFNRKLVGLD--GRLRNFDIIDLALNHLA
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 22-240 219 1-21 368-404 241-367 21 37 slipknot
view details
3.1 22-367 346 1-21 372-404 368-371 21 33 slipknot
view details
3.1 21-371 351 1-20 374-404 372-373 20 31 slipknot
sequence length 406
structure length 404
publication title Crystal structure of Phosphonoacetate Hydrolase complexed with phosphonoformate
rcsb
molecule tags Hydrolase
molecule keywords PHOSPHONOACETATE HYDROLASE
source organism Pseudomonas fluorescens
missing residues 388-389
total genus Genus: 126
ec nomenclature ec 3.11.1.2: Phosphonoacetate hydrolase.
pdb deposition date 2000-02-24
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 1ei6A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1ei6A01
1ANJA 1HQAA 1B8JA 3M7VA 1KH9A 1AJBA 3UO0A 1EQJA 1KHNA 1ELXA 1KH7A 1ED9A 3IGYB 1N2LA 3M8YA 4FDIA 2GA3A 1AUKA 1ELYA 2IFYA 3UN2A 1ANIA 3BDGA 1KHLA 1K7HA 3TX0A 1AJAA 3BDGB 1ALJA 3UNYA 1ALKA 2GLQA 1SHNA 1KHKA 1HDHA 1E1ZP 1EW9A 3DPCA 3UN3A 3SZYA 3SZZA 1HJKA 3T00A 1ZEDA 3TWZA 3ED4A 1ZEFA 3DYCA 2G9YA 3M8WA 1ELZA 1P49A 3UN5A 3T01A 1Y7AA 1SHQA 2ANHA 1ED8A 3CMRA 3IGZB 1FSUA 1EI6A 3MK1A 1AJCA 1URAA 3BDHA 1E33P 1ALIA 1KHJA 1ZEBA 1E3CP 3MK2A 1EW2A 4FDJA 1AJDA 1N2KA 3M8ZA 1O98A 1KH4A 1URBA 2QZUA 1O99A 1KH5A 1EW8A 3BDFA 3MK0A 1EJJA 3NVLA 1E2SP 3OT9A 3T02A 1Y6VA
chains in the KnotProt database with same CATH superfamily
1ANJA 1HQAA 1B8JA 3M7VA 1KH9A 1AJBA 3UO0A 1EQJA 1KHNA 1ELXA 1KH7A 1ED9A 3IGYB 1N2LA 3M8YA 4FDIA 2GA3A 1AUKA 1ELYA 2IFYA 3UN2A 1ANIA 3BDGA 1KHLA 1K7HA 3TX0A 1AJAA 3BDGB 1ALJA 3UNYA 1ALKA 2GLQA 1SHNA 1KHKA 1HDHA 1E1ZP 1EW9A 3DPCA 3UN3A 3SZYA 3SZZA 1HJKA 3T00A 1ZEDA 3TWZA 3ED4A 1ZEFA 3DYCA 2G9YA 3M8WA 1ELZA 1P49A 3UN5A 3T01A 1Y7AA 1SHQA 2ANHA 1ED8A 3CMRA 3IGZB 1FSUA 1EI6A 3MK1A 1AJCA 1URAA 3BDHA 1E33P 1ALIA 1KHJA 1ZEBA 1E3CP 3MK2A 1EW2A 4FDJA 1AJDA 1N2KA 3M8ZA 1O98A 1KH4A 1URBA 2QZUA 1O99A 1KH5A 1EW8A 3BDFA 3MK0A 1EJJA 3NVLA 1E2SP 3OT9A 3T02A 1Y6VA
chains in the KnotProt database with same CATH topology
1ANJA 1HQAA 1B8JA 3M7VA 1KH9A 1AJBA 3UO0A 1EQJA 1KHNA 1ELXA 1KH7A 1ED9A 3IGYB 1N2LA 3M8YA 4FDIA 2GA3A 1AUKA 1ELYA 2IFYA 3UN2A 1ANIA 3BDGA 1KHLA 1K7HA 3TX0A 1AJAA 3BDGB 1ALJA 3UNYA 1ALKA 2GLQA 1SHNA 1KHKA 1HDHA 1E1ZP 1EW9A 3DPCA 3UN3A 3SZYA 3SZZA 1HJKA 3T00A 1ZEDA 3TWZA 3ED4A 1ZEFA 3DYCA 2G9YA 3M8WA 1ELZA 1P49A 3UN5A 3T01A 1Y7AA 1SHQA 2ANHA 1ED8A 3CMRA 3IGZB 1FSUA 1EI6A 3MK1A 1AJCA 1URAA 3BDHA 1E33P 1ALIA 1KHJA 1ZEBA 1E3CP 3MK2A 1EW2A 4FDJA 1AJDA 1N2KA 3M8ZA 1O98A 1KH4A 1URBA 2QZUA 1O99A 1KH5A 1EW8A 3BDFA 3MK0A 1EJJA 3NVLA 1E2SP 3OT9A 3T02A 1Y6VA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1ANJ A;  1HQA A;  1B8J A;  3M7V A;  1KH9 A;  1AJB A;  3UO0 A;  1EQJ A;  1KHN A;  1ELX A;  1KH7 A;  1ED9 A;  3IGY B;  1N2L A;  3M8Y A;  4FDI A;  2GA3 A;  1AUK A;  1ELY A;  2IFY A;  3UN2 A;  1ANI A;  3BDG A;  1KHL A;  1K7H A;  3TX0 A;  1AJA A;  3BDG B;  1ALJ A;  3UNY A;  1ALK A;  2GLQ A;  1SHN A;  1KHK A;  1HDH A;  1E1Z P;  1EW9 A;  3DPC A;  3UN3 A;  3SZY A;  3SZZ A;  1HJK A;  3T00 A;  1ZED A;  3TWZ A;  3ED4 A;  1ZEF A;  3DYC A;  2G9Y A;  3M8W A;  1ELZ A;  1P49 A;  3UN5 A;  3T01 A;  1Y7A A;  1SHQ A;  2ANH A;  1ED8 A;  3CMR A;  3IGZ B;  1FSU A;  1EI6 A;  3MK1 A;  1AJC A;  1URA A;  3BDH A;  1E33 P;  1ALI A;  1KHJ A;  1ZEB A;  1E3C P;  3MK2 A;  1EW2 A;  4FDJ A;  1AJD A;  1N2K A;  3M8Z A;  1O98 A;  1KH4 A;  1URB A;  2QZU A;  1O99 A;  1KH5 A;  1EW8 A;  3BDF A;  3MK0 A;  1EJJ A;  3NVL A;  1E2S P;  3OT9 A;  3T02 A;  1Y6V A; 
#chains in the KnotProt database with same CATH topology
 1ANJ A;  1HQA A;  1B8J A;  3M7V A;  1KH9 A;  1AJB A;  3UO0 A;  1EQJ A;  1KHN A;  1ELX A;  1KH7 A;  1ED9 A;  3IGY B;  1N2L A;  3M8Y A;  4FDI A;  2GA3 A;  1AUK A;  1ELY A;  2IFY A;  3UN2 A;  1ANI A;  3BDG A;  1KHL A;  1K7H A;  3TX0 A;  1AJA A;  3BDG B;  1ALJ A;  3UNY A;  1ALK A;  2GLQ A;  1SHN A;  1KHK A;  1HDH A;  1E1Z P;  1EW9 A;  3DPC A;  3UN3 A;  3SZY A;  3SZZ A;  1HJK A;  3T00 A;  1ZED A;  3TWZ A;  3ED4 A;  1ZEF A;  3DYC A;  2G9Y A;  3M8W A;  1ELZ A;  1P49 A;  3UN5 A;  3T01 A;  1Y7A A;  1SHQ A;  2ANH A;  1ED8 A;  3CMR A;  3IGZ B;  1FSU A;  1EI6 A;  3MK1 A;  1AJC A;  1URA A;  3BDH A;  1E33 P;  1ALI A;  1KHJ A;  1ZEB A;  1E3C P;  3MK2 A;  1EW2 A;  4FDJ A;  1AJD A;  1N2K A;  3M8Z A;  1O98 A;  1KH4 A;  1URB A;  2QZU A;  1O99 A;  1KH5 A;  1EW8 A;  3BDF A;  3MK0 A;  1EJJ A;  3NVL A;  1E2S P;  3OT9 A;  3T02 A;  1Y6V A; 
#chains in the KnotProt database with same CATH homology
 1ANJ A;  1HQA A;  1B8J A;  3M7V A;  1KH9 A;  1AJB A;  3UO0 A;  1EQJ A;  1KHN A;  1ELX A;  1KH7 A;  1ED9 A;  3IGY B;  1N2L A;  3M8Y A;  4FDI A;  2GA3 A;  1AUK A;  1ELY A;  2IFY A;  3UN2 A;  1ANI A;  3BDG A;  1KHL A;  1K7H A;  3TX0 A;  1AJA A;  3BDG B;  1ALJ A;  3UNY A;  1ALK A;  2GLQ A;  1SHN A;  1KHK A;  1HDH A;  1E1Z P;  1EW9 A;  3DPC A;  3UN3 A;  3SZY A;  3SZZ A;  1HJK A;  3T00 A;  1ZED A;  3TWZ A;  3ED4 A;  1ZEF A;  3DYC A;  2G9Y A;  3M8W A;  1ELZ A;  1P49 A;  3UN5 A;  3T01 A;  1Y7A A;  1SHQ A;  2ANH A;  1ED8 A;  3CMR A;  3IGZ B;  1FSU A;  1EI6 A;  3MK1 A;  1AJC A;  1URA A;  3BDH A;  1E33 P;  1ALI A;  1KHJ A;  1ZEB A;  1E3C P;  3MK2 A;  1EW2 A;  4FDJ A;  1AJD A;  1N2K A;  3M8Z A;  1O98 A;  1KH4 A;  1URB A;  2QZU A;  1O99 A;  1KH5 A;  1EW8 A;  3BDF A;  3MK0 A;  1EJJ A;  3NVL A;  1E2S P;  3OT9 A;  3T02 A;  1Y6V A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling