3UO0A

Phosphorylated bacillus cereus phosphopentomutase soaked with glucose 1,6-bisphosphate
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 7-324 318 1-6 343-391 325-342 6 49 slipknot
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDTMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 6-327 322 1-5 332-391 328-331 5 60 slipknot
view details
3.1 7-329 323 1-6 338-391 330-337 6 54 slipknot
view details
2.1 5-340 336 1-4 345-391 341-344 4 47 slipknot
sequence length 391
structure length 391
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords Phosphopentomutase
source organism Bacillus cereus
total genus Genus: 138
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-16
KnotProt deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3uo0A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3uo0A01
3ED4A 3TX0A 3MK2A 1ANJA 1ED9A 1HJKA 1KH9A 3UNYA 1O99A 1EJJA 1KH7A 1EQJA 1Y6VA 3M8YA 1EW9A 3TWZA 3OT9A 3T02A 1E2SP 1EW2A 2G9YA 1KH5A 1KHLA 1SHNA 1ALIA 3T00A 3M7VA 3CMRA 1N2LA 1URBA 1ELXA 3NVLA 1E1ZP 3DYCA 1N2KA 1K7HA 2GA3A 3BDGA 1AJBA 3M8ZA 1HDHA 4FDIA 1ALKA 3IGZB 1AJDA 1SHQA 3UO0A 1AJCA 1Y7AA 3UN5A 1E3CP 1ELZA 1ED8A 1URAA 1ZEFA 1E33P 1KHJA 3BDHA 1ALJA 1B8JA 4FDJA 1P49A 1KHNA 1AUKA 3MK0A 3SZYA 1HQAA 1KHKA 1AJAA 3UN3A 1ZEDA 1EI6A 1ZEBA 3SZZA 1O98A 3M8WA 1FSUA 3BDGB 1ANIA 1ELYA 1EW8A 2ANHA 1KH4A 2GLQA 3IGYB 2IFYA 2QZUA 3MK1A 3T01A 3UN2A 3BDFA 3DPCA
chains in the KnotProt database with same CATH superfamily
3ED4A 3TX0A 3MK2A 1ANJA 1ED9A 1HJKA 1KH9A 3UNYA 3D7SB 1O99A 1EJJA 1KH7A 1EQJA 1Y6VA 3M8YA 1EW9A 3TWZA 3OT9A 3T02A 1E2SP 1EW2A 2G9YA 3D7SD 1KH5A 1KHLA 1SHNA 1ALIA 3T00A 3M7VA 3CMRA 1N2LA 1URBA 1ELXA 3NVLA 1E1ZP 3DYCA 1N2KA 1K7HA 2GA3A 3BDGA 1AJBA 3M8ZA 1HDHA 4FDIA 1ALKA 3IGZB 1AJDA 1SHQA 3UO0A 1AJCA 1Y7AA 3UN5A 1E3CP 1ELZA 1ED8A 1URAA 1ZEFA 1E33P 1KHJA 3BDHA 1ALJA 1B8JA 4FDJA 1P49A 1KHNA 1AUKA 3MK0A 3SZYA 1HQAA 1KHKA 1AJAA 3UN3A 1ZEDA 1EI6A 1ZEBA 3SZZA 1O98A 3M8WA 1FSUA 3BDGB 1ANIA 1ELYA 1EW8A 2ANHA 1KH4A 2GLQA 3IGYB 2IFYA 2QZUA 3MK1A 3T01A 3UN2A 3BDFA 3DPCA
chains in the KnotProt database with same CATH topology
3ED4A 3TX0A 3MK2A 1ANJA 1ED9A 1HJKA 1KH9A 3UNYA 1O99A 1EJJA 1KH7A 1EQJA 1Y6VA 3M8YA 1EW9A 3TWZA 3OT9A 3T02A 1E2SP 1EW2A 2G9YA 1KH5A 1KHLA 1SHNA 1ALIA 3T00A 3M7VA 3CMRA 1N2LA 1URBA 1ELXA 3NVLA 1E1ZP 3DYCA 1N2KA 1K7HA 2GA3A 3BDGA 1AJBA 3M8ZA 1HDHA 4FDIA 1ALKA 3IGZB 1AJDA 1SHQA 3UO0A 1AJCA 1Y7AA 3UN5A 1E3CP 1ELZA 1ED8A 1URAA 1ZEFA 1E33P 1KHJA 3BDHA 1ALJA 1B8JA 4FDJA 1P49A 1KHNA 1AUKA 3MK0A 3SZYA 1HQAA 1KHKA 1AJAA 3UN3A 1ZEDA 1EI6A 1ZEBA 3SZZA 1O98A 3M8WA 1FSUA 3BDGB 1ANIA 1ELYA 1EW8A 2ANHA 1KH4A 2GLQA 3IGYB 2IFYA 2QZUA 3MK1A 3T01A 3UN2A 3BDFA 3DPCA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3ED4 A;  3TX0 A;  3MK2 A;  1ANJ A;  1ED9 A;  1HJK A;  1KH9 A;  3UNY A;  1O99 A;  1EJJ A;  1KH7 A;  1EQJ A;  1Y6V A;  3M8Y A;  1EW9 A;  3TWZ A;  3OT9 A;  3T02 A;  1E2S P;  1EW2 A;  2G9Y A;  1KH5 A;  1KHL A;  1SHN A;  1ALI A;  3T00 A;  3M7V A;  3CMR A;  1N2L A;  1URB A;  1ELX A;  3NVL A;  1E1Z P;  3DYC A;  1N2K A;  1K7H A;  2GA3 A;  3BDG A;  1AJB A;  3M8Z A;  1HDH A;  4FDI A;  1ALK A;  3IGZ B;  1AJD A;  1SHQ A;  3UO0 A;  1AJC A;  1Y7A A;  3UN5 A;  1E3C P;  1ELZ A;  1ED8 A;  1URA A;  1ZEF A;  1E33 P;  1KHJ A;  3BDH A;  1ALJ A;  1B8J A;  4FDJ A;  1P49 A;  1KHN A;  1AUK A;  3MK0 A;  3SZY A;  1HQA A;  1KHK A;  1AJA A;  3UN3 A;  1ZED A;  1EI6 A;  1ZEB A;  3SZZ A;  1O98 A;  3M8W A;  1FSU A;  3BDG B;  1ANI A;  1ELY A;  1EW8 A;  2ANH A;  1KH4 A;  2GLQ A;  3IGY B;  2IFY A;  2QZU A;  3MK1 A;  3T01 A;  3UN2 A;  3BDF A;  3DPC A; 
#chains in the KnotProt database with same CATH topology
 3ED4 A;  3TX0 A;  3MK2 A;  1ANJ A;  1ED9 A;  1HJK A;  1KH9 A;  3UNY A;  3D7S B;  1O99 A;  1EJJ A;  1KH7 A;  1EQJ A;  1Y6V A;  3M8Y A;  1EW9 A;  3TWZ A;  3OT9 A;  3T02 A;  1E2S P;  1EW2 A;  2G9Y A;  3D7S D;  1KH5 A;  1KHL A;  1SHN A;  1ALI A;  3T00 A;  3M7V A;  3CMR A;  1N2L A;  1URB A;  1ELX A;  3NVL A;  1E1Z P;  3DYC A;  1N2K A;  1K7H A;  2GA3 A;  3BDG A;  1AJB A;  3M8Z A;  1HDH A;  4FDI A;  1ALK A;  3IGZ B;  1AJD A;  1SHQ A;  3UO0 A;  1AJC A;  1Y7A A;  3UN5 A;  1E3C P;  1ELZ A;  1ED8 A;  1URA A;  1ZEF A;  1E33 P;  1KHJ A;  3BDH A;  1ALJ A;  1B8J A;  4FDJ A;  1P49 A;  1KHN A;  1AUK A;  3MK0 A;  3SZY A;  1HQA A;  1KHK A;  1AJA A;  3UN3 A;  1ZED A;  1EI6 A;  1ZEB A;  3SZZ A;  1O98 A;  3M8W A;  1FSU A;  3BDG B;  1ANI A;  1ELY A;  1EW8 A;  2ANH A;  1KH4 A;  2GLQ A;  3IGY B;  2IFY A;  2QZU A;  3MK1 A;  3T01 A;  3UN2 A;  3BDF A;  3DPC A; 
#chains in the KnotProt database with same CATH homology
 3ED4 A;  3TX0 A;  3MK2 A;  1ANJ A;  1ED9 A;  1HJK A;  1KH9 A;  3UNY A;  1O99 A;  1EJJ A;  1KH7 A;  1EQJ A;  1Y6V A;  3M8Y A;  1EW9 A;  3TWZ A;  3OT9 A;  3T02 A;  1E2S P;  1EW2 A;  2G9Y A;  1KH5 A;  1KHL A;  1SHN A;  1ALI A;  3T00 A;  3M7V A;  3CMR A;  1N2L A;  1URB A;  1ELX A;  3NVL A;  1E1Z P;  3DYC A;  1N2K A;  1K7H A;  2GA3 A;  3BDG A;  1AJB A;  3M8Z A;  1HDH A;  4FDI A;  1ALK A;  3IGZ B;  1AJD A;  1SHQ A;  3UO0 A;  1AJC A;  1Y7A A;  3UN5 A;  1E3C P;  1ELZ A;  1ED8 A;  1URA A;  1ZEF A;  1E33 P;  1KHJ A;  3BDH A;  1ALJ A;  1B8J A;  4FDJ A;  1P49 A;  1KHN A;  1AUK A;  3MK0 A;  3SZY A;  1HQA A;  1KHK A;  1AJA A;  3UN3 A;  1ZED A;  1EI6 A;  1ZEB A;  3SZZ A;  1O98 A;  3M8W A;  1FSU A;  3BDG B;  1ANI A;  1ELY A;  1EW8 A;  2ANH A;  1KH4 A;  2GLQ A;  3IGY B;  2IFY A;  2QZU A;  3MK1 A;  3T01 A;  3UN2 A;  3BDF A;  3DPC A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling