3UNYA

Bacillus cereus phosphopentomutase t85e variant soaked with glucose 1,6-bisphosphate
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 6-326 321 1-5 343-391 327-342 5 49 slipknot
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDEMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 7-329 323 1-6 339-391 330-338 6 53 slipknot
view details
2.1 5-340 336 1-4 344-391 341-343 4 48 slipknot
sequence length 391
structure length 391
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords Phosphopentomutase
source organism Bacillus cereus
total genus Genus: 140
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-16
KnotProt deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3unyA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3unyA01
1AJAA 1KHJA 3SZZA 3M7VA 1URBA 1EW8A 1EQJA 1EI6A 3M8WA 1HDHA 3UN3A 4FDIA 1ELZA 1EW9A 1AJCA 3MK1A 1ANJA 1Y6VA 3T02A 3UO0A 2GA3A 1KHKA 1E2SP 1N2KA 2ANHA 1KH7A 3SZYA 1O99A 1P49A 3M8YA 1KH5A 3BDGB 1EJJA 1ALJA 1EW2A 3OT9A 3BDFA 1ED8A 3T00A 1KH9A 1ED9A 2QZUA 1KHLA 1HQAA 1E33P 3BDHA 3T01A 1ELXA 3BDGA 1ZEDA 1B8JA 1AUKA 1KHNA 1SHQA 3ED4A 3IGZB 1K7HA 1HJKA 3TWZA 4FDJA 3UN5A 3DYCA 1ZEBA 1N2LA 1O98A 1ELYA 3CMRA 1AJBA 3UN2A 2GLQA 1URAA 1ZEFA 1ALKA 1FSUA 2G9YA 1ANIA 1ALIA 3MK0A 2IFYA 1Y7AA 3IGYB 3NVLA 3TX0A 3M8ZA 1E3CP 1E1ZP 1SHNA 3MK2A 1AJDA 3DPCA 3UNYA 1KH4A
chains in the KnotProt database with same CATH superfamily
1AJAA 1KHJA 3SZZA 3M7VA 1URBA 1EW8A 1EQJA 1EI6A 3M8WA 1HDHA 3UN3A 4FDIA 1ELZA 1EW9A 1AJCA 3MK1A 1ANJA 3D7SB 1Y6VA 3T02A 3UO0A 2GA3A 1KHKA 1E2SP 1N2KA 2ANHA 1KH7A 3SZYA 1O99A 1P49A 3M8YA 1KH5A 3BDGB 1EJJA 1ALJA 1EW2A 3OT9A 3BDFA 1ED8A 3D7SD 3T00A 1KH9A 1ED9A 2QZUA 1KHLA 1HQAA 1E33P 3BDHA 3T01A 1ELXA 3BDGA 1ZEDA 1B8JA 1AUKA 1KHNA 1SHQA 3ED4A 3IGZB 1K7HA 1HJKA 3TWZA 4FDJA 3UN5A 3DYCA 1ZEBA 1N2LA 1O98A 1ELYA 3CMRA 1AJBA 3UN2A 2GLQA 1URAA 1ZEFA 1ALKA 1FSUA 2G9YA 1ANIA 1ALIA 3MK0A 2IFYA 1Y7AA 3IGYB 3NVLA 3TX0A 3M8ZA 1E3CP 1E1ZP 1SHNA 3MK2A 1AJDA 3DPCA 3UNYA 1KH4A
chains in the KnotProt database with same CATH topology
1AJAA 1KHJA 3SZZA 3M7VA 1URBA 1EW8A 1EQJA 1EI6A 3M8WA 1HDHA 3UN3A 4FDIA 1ELZA 1EW9A 1AJCA 3MK1A 1ANJA 1Y6VA 3T02A 3UO0A 2GA3A 1KHKA 1E2SP 1N2KA 2ANHA 1KH7A 3SZYA 1O99A 1P49A 3M8YA 1KH5A 3BDGB 1EJJA 1ALJA 1EW2A 3OT9A 3BDFA 1ED8A 3T00A 1KH9A 1ED9A 2QZUA 1KHLA 1HQAA 1E33P 3BDHA 3T01A 1ELXA 3BDGA 1ZEDA 1B8JA 1AUKA 1KHNA 1SHQA 3ED4A 3IGZB 1K7HA 1HJKA 3TWZA 4FDJA 3UN5A 3DYCA 1ZEBA 1N2LA 1O98A 1ELYA 3CMRA 1AJBA 3UN2A 2GLQA 1URAA 1ZEFA 1ALKA 1FSUA 2G9YA 1ANIA 1ALIA 3MK0A 2IFYA 1Y7AA 3IGYB 3NVLA 3TX0A 3M8ZA 1E3CP 1E1ZP 1SHNA 3MK2A 1AJDA 3DPCA 3UNYA 1KH4A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1AJA A;  1KHJ A;  3SZZ A;  3M7V A;  1URB A;  1EW8 A;  1EQJ A;  1EI6 A;  3M8W A;  1HDH A;  3UN3 A;  4FDI A;  1ELZ A;  1EW9 A;  1AJC A;  3MK1 A;  1ANJ A;  1Y6V A;  3T02 A;  3UO0 A;  2GA3 A;  1KHK A;  1E2S P;  1N2K A;  2ANH A;  1KH7 A;  3SZY A;  1O99 A;  1P49 A;  3M8Y A;  1KH5 A;  3BDG B;  1EJJ A;  1ALJ A;  1EW2 A;  3OT9 A;  3BDF A;  1ED8 A;  3T00 A;  1KH9 A;  1ED9 A;  2QZU A;  1KHL A;  1HQA A;  1E33 P;  3BDH A;  3T01 A;  1ELX A;  3BDG A;  1ZED A;  1B8J A;  1AUK A;  1KHN A;  1SHQ A;  3ED4 A;  3IGZ B;  1K7H A;  1HJK A;  3TWZ A;  4FDJ A;  3UN5 A;  3DYC A;  1ZEB A;  1N2L A;  1O98 A;  1ELY A;  3CMR A;  1AJB A;  3UN2 A;  2GLQ A;  1URA A;  1ZEF A;  1ALK A;  1FSU A;  2G9Y A;  1ANI A;  1ALI A;  3MK0 A;  2IFY A;  1Y7A A;  3IGY B;  3NVL A;  3TX0 A;  3M8Z A;  1E3C P;  1E1Z P;  1SHN A;  3MK2 A;  1AJD A;  3DPC A;  3UNY A;  1KH4 A; 
#chains in the KnotProt database with same CATH topology
 1AJA A;  1KHJ A;  3SZZ A;  3M7V A;  1URB A;  1EW8 A;  1EQJ A;  1EI6 A;  3M8W A;  1HDH A;  3UN3 A;  4FDI A;  1ELZ A;  1EW9 A;  1AJC A;  3MK1 A;  1ANJ A;  3D7S B;  1Y6V A;  3T02 A;  3UO0 A;  2GA3 A;  1KHK A;  1E2S P;  1N2K A;  2ANH A;  1KH7 A;  3SZY A;  1O99 A;  1P49 A;  3M8Y A;  1KH5 A;  3BDG B;  1EJJ A;  1ALJ A;  1EW2 A;  3OT9 A;  3BDF A;  1ED8 A;  3D7S D;  3T00 A;  1KH9 A;  1ED9 A;  2QZU A;  1KHL A;  1HQA A;  1E33 P;  3BDH A;  3T01 A;  1ELX A;  3BDG A;  1ZED A;  1B8J A;  1AUK A;  1KHN A;  1SHQ A;  3ED4 A;  3IGZ B;  1K7H A;  1HJK A;  3TWZ A;  4FDJ A;  3UN5 A;  3DYC A;  1ZEB A;  1N2L A;  1O98 A;  1ELY A;  3CMR A;  1AJB A;  3UN2 A;  2GLQ A;  1URA A;  1ZEF A;  1ALK A;  1FSU A;  2G9Y A;  1ANI A;  1ALI A;  3MK0 A;  2IFY A;  1Y7A A;  3IGY B;  3NVL A;  3TX0 A;  3M8Z A;  1E3C P;  1E1Z P;  1SHN A;  3MK2 A;  1AJD A;  3DPC A;  3UNY A;  1KH4 A; 
#chains in the KnotProt database with same CATH homology
 1AJA A;  1KHJ A;  3SZZ A;  3M7V A;  1URB A;  1EW8 A;  1EQJ A;  1EI6 A;  3M8W A;  1HDH A;  3UN3 A;  4FDI A;  1ELZ A;  1EW9 A;  1AJC A;  3MK1 A;  1ANJ A;  1Y6V A;  3T02 A;  3UO0 A;  2GA3 A;  1KHK A;  1E2S P;  1N2K A;  2ANH A;  1KH7 A;  3SZY A;  1O99 A;  1P49 A;  3M8Y A;  1KH5 A;  3BDG B;  1EJJ A;  1ALJ A;  1EW2 A;  3OT9 A;  3BDF A;  1ED8 A;  3T00 A;  1KH9 A;  1ED9 A;  2QZU A;  1KHL A;  1HQA A;  1E33 P;  3BDH A;  3T01 A;  1ELX A;  3BDG A;  1ZED A;  1B8J A;  1AUK A;  1KHN A;  1SHQ A;  3ED4 A;  3IGZ B;  1K7H A;  1HJK A;  3TWZ A;  4FDJ A;  3UN5 A;  3DYC A;  1ZEB A;  1N2L A;  1O98 A;  1ELY A;  3CMR A;  1AJB A;  3UN2 A;  2GLQ A;  1URA A;  1ZEF A;  1ALK A;  1FSU A;  2G9Y A;  1ANI A;  1ALI A;  3MK0 A;  2IFY A;  1Y7A A;  3IGY B;  3NVL A;  3TX0 A;  3M8Z A;  1E3C P;  1E1Z P;  1SHN A;  3MK2 A;  1AJD A;  3DPC A;  3UNY A;  1KH4 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling