3UN3A

Phosphopentomutase t85q variant soaked with glucose 1,6-bisphosphate
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 6-328 323 1-5 343-391 329-342 5 49 slipknot
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDQMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 5-326 322 1-4 332-391 327-331 4 60 slipknot
view details
3.1 6-331 326 1-5 338-391 332-337 5 54 slipknot
sequence length 391
structure length 391
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords Phosphopentomutase
source organism Bacillus cereus
total genus Genus: 140
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un3A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un3A01
1HDHA 1KHLA 1HJKA 1KHJA 3BDFA 1EW8A 1ELYA 1ELZA 1EJJA 1KH7A 1KHKA 1Y7AA 2QZUA 1AJCA 1K7HA 3SZYA 3BDHA 3MK0A 1URBA 3DPCA 1AJBA 1ELXA 2G9YA 1AUKA 3UN2A 1E33P 3ED4A 1SHQA 1O98A 3M8YA 1AJDA 1FSUA 3BDGB 4FDIA 1EW9A 1ALJA 1KHNA 3MK2A 3SZZA 3M7VA 1E1ZP 3IGYB 3UO0A 1ZEBA 3TX0A 1ANIA 1E2SP 1E3CP 1N2KA 1ALIA 1Y6VA 1ED9A 3UN3A 3UN5A 1ZEDA 3OT9A 1B8JA 1ALKA 1P49A 2IFYA 3IGZB 3MK1A 3NVLA 3T02A 1AJAA 1URAA 1HQAA 1O99A 1ANJA 4FDJA 2GA3A 3UNYA 1EW2A 2GLQA 3TWZA 1KH5A 2ANHA 1EQJA 1EI6A 3BDGA 1ED8A 3T00A 1KH4A 1KH9A 1N2LA 3CMRA 3DYCA 1SHNA 3M8ZA 3T01A 3M8WA 1ZEFA
chains in the KnotProt database with same CATH superfamily
1HDHA 1KHLA 1HJKA 1KHJA 3BDFA 1EW8A 1ELYA 1ELZA 1EJJA 3D7SD 1KH7A 1KHKA 1Y7AA 2QZUA 1AJCA 1K7HA 3SZYA 3BDHA 3MK0A 1URBA 3DPCA 1AJBA 1ELXA 2G9YA 1AUKA 3UN2A 1E33P 3ED4A 1SHQA 1O98A 3M8YA 1AJDA 1FSUA 3BDGB 4FDIA 1EW9A 1ALJA 1KHNA 3MK2A 3SZZA 3M7VA 1E1ZP 3IGYB 3UO0A 1ZEBA 3TX0A 1ANIA 1E2SP 1E3CP 1N2KA 1ALIA 1Y6VA 1ED9A 3UN3A 3UN5A 1ZEDA 3OT9A 1B8JA 1ALKA 1P49A 2IFYA 3IGZB 3MK1A 3NVLA 3T02A 1AJAA 1URAA 1HQAA 1O99A 1ANJA 4FDJA 2GA3A 3UNYA 1EW2A 2GLQA 3TWZA 1KH5A 2ANHA 1EQJA 1EI6A 3BDGA 1ED8A 3T00A 1KH4A 3D7SB 1KH9A 1N2LA 3CMRA 3DYCA 1SHNA 3M8ZA 3T01A 3M8WA 1ZEFA
chains in the KnotProt database with same CATH topology
1HDHA 1KHLA 1HJKA 1KHJA 3BDFA 1EW8A 1ELYA 1ELZA 1EJJA 1KH7A 1KHKA 1Y7AA 2QZUA 1AJCA 1K7HA 3SZYA 3BDHA 3MK0A 1URBA 3DPCA 1AJBA 1ELXA 2G9YA 1AUKA 3UN2A 1E33P 3ED4A 1SHQA 1O98A 3M8YA 1AJDA 1FSUA 3BDGB 4FDIA 1EW9A 1ALJA 1KHNA 3MK2A 3SZZA 3M7VA 1E1ZP 3IGYB 3UO0A 1ZEBA 3TX0A 1ANIA 1E2SP 1E3CP 1N2KA 1ALIA 1Y6VA 1ED9A 3UN3A 3UN5A 1ZEDA 3OT9A 1B8JA 1ALKA 1P49A 2IFYA 3IGZB 3MK1A 3NVLA 3T02A 1AJAA 1URAA 1HQAA 1O99A 1ANJA 4FDJA 2GA3A 3UNYA 1EW2A 2GLQA 3TWZA 1KH5A 2ANHA 1EQJA 1EI6A 3BDGA 1ED8A 3T00A 1KH4A 1KH9A 1N2LA 3CMRA 3DYCA 1SHNA 3M8ZA 3T01A 3M8WA 1ZEFA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1HDH A;  1KHL A;  1HJK A;  1KHJ A;  3BDF A;  1EW8 A;  1ELY A;  1ELZ A;  1EJJ A;  1KH7 A;  1KHK A;  1Y7A A;  2QZU A;  1AJC A;  1K7H A;  3SZY A;  3BDH A;  3MK0 A;  1URB A;  3DPC A;  1AJB A;  1ELX A;  2G9Y A;  1AUK A;  3UN2 A;  1E33 P;  3ED4 A;  1SHQ A;  1O98 A;  3M8Y A;  1AJD A;  1FSU A;  3BDG B;  4FDI A;  1EW9 A;  1ALJ A;  1KHN A;  3MK2 A;  3SZZ A;  3M7V A;  1E1Z P;  3IGY B;  3UO0 A;  1ZEB A;  3TX0 A;  1ANI A;  1E2S P;  1E3C P;  1N2K A;  1ALI A;  1Y6V A;  1ED9 A;  3UN3 A;  3UN5 A;  1ZED A;  3OT9 A;  1B8J A;  1ALK A;  1P49 A;  2IFY A;  3IGZ B;  3MK1 A;  3NVL A;  3T02 A;  1AJA A;  1URA A;  1HQA A;  1O99 A;  1ANJ A;  4FDJ A;  2GA3 A;  3UNY A;  1EW2 A;  2GLQ A;  3TWZ A;  1KH5 A;  2ANH A;  1EQJ A;  1EI6 A;  3BDG A;  1ED8 A;  3T00 A;  1KH4 A;  1KH9 A;  1N2L A;  3CMR A;  3DYC A;  1SHN A;  3M8Z A;  3T01 A;  3M8W A;  1ZEF A; 
#chains in the KnotProt database with same CATH topology
 1HDH A;  1KHL A;  1HJK A;  1KHJ A;  3BDF A;  1EW8 A;  1ELY A;  1ELZ A;  1EJJ A;  3D7S D;  1KH7 A;  1KHK A;  1Y7A A;  2QZU A;  1AJC A;  1K7H A;  3SZY A;  3BDH A;  3MK0 A;  1URB A;  3DPC A;  1AJB A;  1ELX A;  2G9Y A;  1AUK A;  3UN2 A;  1E33 P;  3ED4 A;  1SHQ A;  1O98 A;  3M8Y A;  1AJD A;  1FSU A;  3BDG B;  4FDI A;  1EW9 A;  1ALJ A;  1KHN A;  3MK2 A;  3SZZ A;  3M7V A;  1E1Z P;  3IGY B;  3UO0 A;  1ZEB A;  3TX0 A;  1ANI A;  1E2S P;  1E3C P;  1N2K A;  1ALI A;  1Y6V A;  1ED9 A;  3UN3 A;  3UN5 A;  1ZED A;  3OT9 A;  1B8J A;  1ALK A;  1P49 A;  2IFY A;  3IGZ B;  3MK1 A;  3NVL A;  3T02 A;  1AJA A;  1URA A;  1HQA A;  1O99 A;  1ANJ A;  4FDJ A;  2GA3 A;  3UNY A;  1EW2 A;  2GLQ A;  3TWZ A;  1KH5 A;  2ANH A;  1EQJ A;  1EI6 A;  3BDG A;  1ED8 A;  3T00 A;  1KH4 A;  3D7S B;  1KH9 A;  1N2L A;  3CMR A;  3DYC A;  1SHN A;  3M8Z A;  3T01 A;  3M8W A;  1ZEF A; 
#chains in the KnotProt database with same CATH homology
 1HDH A;  1KHL A;  1HJK A;  1KHJ A;  3BDF A;  1EW8 A;  1ELY A;  1ELZ A;  1EJJ A;  1KH7 A;  1KHK A;  1Y7A A;  2QZU A;  1AJC A;  1K7H A;  3SZY A;  3BDH A;  3MK0 A;  1URB A;  3DPC A;  1AJB A;  1ELX A;  2G9Y A;  1AUK A;  3UN2 A;  1E33 P;  3ED4 A;  1SHQ A;  1O98 A;  3M8Y A;  1AJD A;  1FSU A;  3BDG B;  4FDI A;  1EW9 A;  1ALJ A;  1KHN A;  3MK2 A;  3SZZ A;  3M7V A;  1E1Z P;  3IGY B;  3UO0 A;  1ZEB A;  3TX0 A;  1ANI A;  1E2S P;  1E3C P;  1N2K A;  1ALI A;  1Y6V A;  1ED9 A;  3UN3 A;  3UN5 A;  1ZED A;  3OT9 A;  1B8J A;  1ALK A;  1P49 A;  2IFY A;  3IGZ B;  3MK1 A;  3NVL A;  3T02 A;  1AJA A;  1URA A;  1HQA A;  1O99 A;  1ANJ A;  4FDJ A;  2GA3 A;  3UNY A;  1EW2 A;  2GLQ A;  3TWZ A;  1KH5 A;  2ANH A;  1EQJ A;  1EI6 A;  3BDG A;  1ED8 A;  3T00 A;  1KH4 A;  1KH9 A;  1N2L A;  3CMR A;  3DYC A;  1SHN A;  3M8Z A;  3T01 A;  3M8W A;  1ZEF A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling