1B8JA

Alkaline phosphatase complexed with vanadate
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 46-369 324 1-45 420-449 370-419 45 30 slipknot
Chain Sequence
TPEMPVLENRAAQGDITAPGGARRLTGDQTAALRDSLSDKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDYVTDXAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAGEWQGKTLREQAQARGYQLVSDAASLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKEGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 47-373 327 1-46 412-449 374-411 46 38 slipknot
view details
3.1 45-411 367 1-44 421-449 412-420 44 29 slipknot
view details
2.1 26-367 342 1-11, 373-449 12-25, 368-372 11 77 slipknot
view details
2.1 45-367 323 1-30, 373-449 31-44, 368-372 30 77 slipknot
sequence length 449
structure length 449
publication title A model of the transition state in the alkaline phosphatase reaction.
pubmed doi rcsb
molecule tags Alkaline phosphatase
molecule keywords PROTEIN (ALKALINE PHOSPHATASE)
source organism Escherichia coli
total genus Genus: 163
ec nomenclature ec 3.1.3.1: Alkaline phosphatase.
pdb deposition date 1999-02-01
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00245 Alk_phosphatase Alkaline phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1b8jA00
1P49A 1ELXA 3TWZA 1ED8A 3T02A 1Y7AA 2G9YA 3ED4A 4FDIA 3DYCA 1EW9A 1HDHA 2IFYA 3BDFA 1ELZA 3M8ZA 1HQAA 1O99A 1AJCA 1ANJA 3MK2A 3UN2A 3M8YA 1ZEBA 2GLQA 4FDJA 1ED9A 3UN5A 1E33P 1FSUA 3UO0A 3DPCA 3NVLA 1KH4A 1URAA 1ZEDA 1KHKA 2ANHA 3BDHA 1O98A 1AJDA 1K7HA 2QZUA 3T00A 1ANIA 1SHQA 1ALKA 1ZEFA 3UNYA 3IGZB 3OT9A 1KH9A 1KHJA 1KH5A 1KHNA 1E2SP 1EI6A 3BDGA 1E1ZP 1EW8A 3TX0A 3IGYB 3CMRA 2GA3A 1AJAA 1EQJA 1AJBA 1ALIA 1KH7A 1AUKA 1ALHA 1ELYA 1HJKA 1SHNA 3M8WA 1B8JA 1URBA 1Y6VA 3SZZA 3UN3A 3T01A 1N2KA 3SZYA 3MK1A 1EJJA 1ALJA 3MK0A 3M7VA 3BDGB 1KHLA 1E3CP 1EW2A 1N2LA
chains in the KnotProt database with same CATH superfamily
1P49A 1ELXA 3TWZA 1ED8A 3T02A 1Y7AA 2G9YA 3ED4A 4FDIA 3DYCA 1EW9A 1HDHA 2IFYA 3BDFA 1ELZA 3M8ZA 1HQAA 1O99A 1AJCA 1ANJA 3MK2A 3UN2A 3M8YA 1ZEBA 2GLQA 4FDJA 1ED9A 3UN5A 1E33P 1FSUA 3UO0A 3DPCA 3NVLA 1KH4A 1URAA 1ZEDA 1KHKA 2ANHA 3BDHA 1O98A 1AJDA 1K7HA 2QZUA 3T00A 1ANIA 1SHQA 1ALKA 1ZEFA 3UNYA 3IGZB 3OT9A 1KH9A 1KHJA 1KH5A 1KHNA 1E2SP 1EI6A 3BDGA 1E1ZP 1EW8A 3TX0A 3IGYB 3CMRA 2GA3A 1AJAA 1EQJA 1AJBA 1ALIA 1KH7A 1AUKA 1ALHA 1ELYA 1HJKA 1SHNA 3M8WA 1B8JA 1URBA 1Y6VA 3SZZA 3UN3A 3T01A 1N2KA 3SZYA 3MK1A 1EJJA 1ALJA 3MK0A 3M7VA 3BDGB 1KHLA 1E3CP 1EW2A 1N2LA
chains in the KnotProt database with same CATH topology
1P49A 1ELXA 3TWZA 1ED8A 3T02A 1Y7AA 2G9YA 3ED4A 4FDIA 3DYCA 1EW9A 1HDHA 2IFYA 3BDFA 1ELZA 3M8ZA 1HQAA 1O99A 1AJCA 1ANJA 3MK2A 3UN2A 3M8YA 1ZEBA 2GLQA 4FDJA 1ED9A 3UN5A 1E33P 1FSUA 3UO0A 3DPCA 3NVLA 1KH4A 1URAA 1ZEDA 1KHKA 2ANHA 3BDHA 1O98A 1AJDA 1K7HA 2QZUA 3T00A 1ANIA 1SHQA 1ALKA 1ZEFA 3UNYA 3IGZB 3OT9A 1KH9A 1KHJA 1KH5A 1KHNA 1E2SP 1EI6A 3BDGA 1E1ZP 1EW8A 3TX0A 3IGYB 3CMRA 2GA3A 1AJAA 1EQJA 1AJBA 1ALIA 1KH7A 1AUKA 1ALHA 1ELYA 1HJKA 1SHNA 3M8WA 1B8JA 1URBA 1Y6VA 3SZZA 3UN3A 3T01A 1N2KA 3SZYA 3MK1A 1EJJA 1ALJA 3MK0A 3M7VA 3BDGB 1KHLA 1E3CP 1EW2A 1N2LA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1P49 A;  1ELX A;  3TWZ A;  1ED8 A;  3T02 A;  1Y7A A;  2G9Y A;  3ED4 A;  4FDI A;  3DYC A;  1EW9 A;  1HDH A;  2IFY A;  3BDF A;  1ELZ A;  3M8Z A;  1HQA A;  1O99 A;  1AJC A;  1ANJ A;  3MK2 A;  3UN2 A;  3M8Y A;  1ZEB A;  2GLQ A;  4FDJ A;  1ED9 A;  3UN5 A;  1E33 P;  1FSU A;  3UO0 A;  3DPC A;  3NVL A;  1KH4 A;  1URA A;  1ZED A;  1KHK A;  2ANH A;  3BDH A;  1O98 A;  1AJD A;  1K7H A;  2QZU A;  3T00 A;  1ANI A;  1SHQ A;  1ALK A;  1ZEF A;  3UNY A;  3IGZ B;  3OT9 A;  1KH9 A;  1KHJ A;  1KH5 A;  1KHN A;  1E2S P;  1EI6 A;  3BDG A;  1E1Z P;  1EW8 A;  3TX0 A;  3IGY B;  3CMR A;  2GA3 A;  1AJA A;  1EQJ A;  1AJB A;  1ALI A;  1KH7 A;  1AUK A;  1ALH A;  1ELY A;  1HJK A;  1SHN A;  3M8W A;  1B8J A;  1URB A;  1Y6V A;  3SZZ A;  3UN3 A;  3T01 A;  1N2K A;  3SZY A;  3MK1 A;  1EJJ A;  1ALJ A;  3MK0 A;  3M7V A;  3BDG B;  1KHL A;  1E3C P;  1EW2 A;  1N2L A; 
#chains in the KnotProt database with same CATH topology
 1P49 A;  1ELX A;  3TWZ A;  1ED8 A;  3T02 A;  1Y7A A;  2G9Y A;  3ED4 A;  4FDI A;  3DYC A;  1EW9 A;  1HDH A;  2IFY A;  3BDF A;  1ELZ A;  3M8Z A;  1HQA A;  1O99 A;  1AJC A;  1ANJ A;  3MK2 A;  3UN2 A;  3M8Y A;  1ZEB A;  2GLQ A;  4FDJ A;  1ED9 A;  3UN5 A;  1E33 P;  1FSU A;  3UO0 A;  3DPC A;  3NVL A;  1KH4 A;  1URA A;  1ZED A;  1KHK A;  2ANH A;  3BDH A;  1O98 A;  1AJD A;  1K7H A;  2QZU A;  3T00 A;  1ANI A;  1SHQ A;  1ALK A;  1ZEF A;  3UNY A;  3IGZ B;  3OT9 A;  1KH9 A;  1KHJ A;  1KH5 A;  1KHN A;  1E2S P;  1EI6 A;  3BDG A;  1E1Z P;  1EW8 A;  3TX0 A;  3IGY B;  3CMR A;  2GA3 A;  1AJA A;  1EQJ A;  1AJB A;  1ALI A;  1KH7 A;  1AUK A;  1ALH A;  1ELY A;  1HJK A;  1SHN A;  3M8W A;  1B8J A;  1URB A;  1Y6V A;  3SZZ A;  3UN3 A;  3T01 A;  1N2K A;  3SZY A;  3MK1 A;  1EJJ A;  1ALJ A;  3MK0 A;  3M7V A;  3BDG B;  1KHL A;  1E3C P;  1EW2 A;  1N2L A; 
#chains in the KnotProt database with same CATH homology
 1P49 A;  1ELX A;  3TWZ A;  1ED8 A;  3T02 A;  1Y7A A;  2G9Y A;  3ED4 A;  4FDI A;  3DYC A;  1EW9 A;  1HDH A;  2IFY A;  3BDF A;  1ELZ A;  3M8Z A;  1HQA A;  1O99 A;  1AJC A;  1ANJ A;  3MK2 A;  3UN2 A;  3M8Y A;  1ZEB A;  2GLQ A;  4FDJ A;  1ED9 A;  3UN5 A;  1E33 P;  1FSU A;  3UO0 A;  3DPC A;  3NVL A;  1KH4 A;  1URA A;  1ZED A;  1KHK A;  2ANH A;  3BDH A;  1O98 A;  1AJD A;  1K7H A;  2QZU A;  3T00 A;  1ANI A;  1SHQ A;  1ALK A;  1ZEF A;  3UNY A;  3IGZ B;  3OT9 A;  1KH9 A;  1KHJ A;  1KH5 A;  1KHN A;  1E2S P;  1EI6 A;  3BDG A;  1E1Z P;  1EW8 A;  3TX0 A;  3IGY B;  3CMR A;  2GA3 A;  1AJA A;  1EQJ A;  1AJB A;  1ALI A;  1KH7 A;  1AUK A;  1ALH A;  1ELY A;  1HJK A;  1SHN A;  3M8W A;  1B8J A;  1URB A;  1Y6V A;  3SZZ A;  3UN3 A;  3T01 A;  1N2K A;  3SZY A;  3MK1 A;  1EJJ A;  1ALJ A;  3MK0 A;  3M7V A;  3BDG B;  1KHL A;  1E3C P;  1EW2 A;  1N2L A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling