1B8JA

Alkaline phosphatase complexed with vanadate
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 46-369 324 1-45 420-449 370-419 45 30 slipknot
Chain Sequence
TPEMPVLENRAAQGDITAPGGARRLTGDQTAALRDSLSDKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDYVTDXAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAGEWQGKTLREQAQARGYQLVSDAASLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKEGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 47-373 327 1-46 412-449 374-411 46 38 slipknot
view details
3.1 45-411 367 1-44 421-449 412-420 44 29 slipknot
view details
2.1 26-367 342 1-11, 373-449 12-25, 368-372 11 77 slipknot
view details
2.1 45-367 323 1-30, 373-449 31-44, 368-372 30 77 slipknot
sequence length 449
structure length 449
publication title A model of the transition state in the alkaline phosphatase reaction.
pubmed doi rcsb
molecule tags Alkaline phosphatase
molecule keywords PROTEIN (ALKALINE PHOSPHATASE)
source organism Escherichia coli
total genus Genus: 163
ec nomenclature ec 3.1.3.1: Alkaline phosphatase.
pdb deposition date 1999-02-01
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00245 Alk_phosphatase Alkaline phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1b8jA00
1E1ZP 3DPCA 2G9YA 3UN2A 1P49A 3BDHA 3CMRA 3BDGB 2ANHA 3OT9A 1KH7A 3ED4A 1AJCA 1EW8A 2GA3A 3SZZA 1ED9A 2QZUA 3SZYA 1ALIA 1ALJA 1KHLA 1ANJA 3BDFA 1N2KA 3MK2A 1AJDA 1KH9A 1FSUA 3TX0A 1ELXA 1KH5A 1AJBA 1SHQA 1KHKA 3T00A 1E33P 1SHNA 1ZEBA 3BDGA 1Y6VA 1EW9A 1EI6A 1HJKA 1URBA 3TWZA 1E2SP 1ED8A 1ALHA 1AJAA 3MK1A 2IFYA 1ELYA 1HDHA 1EQJA 1ANIA 1ELZA 1AUKA 3M8ZA 1B8JA 3UNYA 1ALKA 3DYCA 3UO0A 1O99A 1N2LA 1KHNA 3NVLA 1E3CP 1HQAA 4FDJA 3T01A 3UN5A 1EJJA 1EW2A 1ZEDA 3T02A 3IGYB 1O98A 1URAA 3M8YA 1KH4A 3UN3A 3M7VA 3M8WA 2GLQA 3IGZB 4FDIA 1K7HA 1ZEFA 1KHJA 1Y7AA 3MK0A
chains in the KnotProt database with same CATH superfamily
1E1ZP 3DPCA 2G9YA 3UN2A 1P49A 3BDHA 3CMRA 3BDGB 2ANHA 3OT9A 1KH7A 3ED4A 1AJCA 1EW8A 2GA3A 3SZZA 1ED9A 2QZUA 3SZYA 1ALIA 1ALJA 1KHLA 1ANJA 3BDFA 1N2KA 3MK2A 1AJDA 1KH9A 1FSUA 3TX0A 1ELXA 1KH5A 1AJBA 1SHQA 1KHKA 3T00A 1E33P 1SHNA 1ZEBA 3BDGA 1Y6VA 1EW9A 1EI6A 1HJKA 1URBA 3TWZA 1E2SP 1ED8A 1ALHA 1AJAA 3MK1A 2IFYA 1ELYA 1HDHA 1EQJA 1ANIA 1ELZA 1AUKA 3M8ZA 1B8JA 3UNYA 1ALKA 3DYCA 3UO0A 1O99A 1N2LA 1KHNA 3NVLA 1E3CP 1HQAA 4FDJA 3T01A 3UN5A 1EJJA 1EW2A 1ZEDA 3T02A 3IGYB 1O98A 1URAA 3M8YA 1KH4A 3UN3A 3M7VA 3M8WA 2GLQA 3IGZB 4FDIA 1K7HA 1ZEFA 1KHJA 1Y7AA 3MK0A
chains in the KnotProt database with same CATH topology
1E1ZP 3DPCA 2G9YA 3UN2A 1P49A 3BDHA 3CMRA 3BDGB 2ANHA 3OT9A 1KH7A 3ED4A 1AJCA 1EW8A 2GA3A 3SZZA 1ED9A 2QZUA 3SZYA 1ALIA 1ALJA 1KHLA 1ANJA 3BDFA 1N2KA 3MK2A 1AJDA 1KH9A 1FSUA 3TX0A 1ELXA 1KH5A 1AJBA 1SHQA 1KHKA 3T00A 1E33P 1SHNA 1ZEBA 3BDGA 1Y6VA 1EW9A 1EI6A 1HJKA 1URBA 3TWZA 1E2SP 1ED8A 1ALHA 1AJAA 3MK1A 2IFYA 1ELYA 1HDHA 1EQJA 1ANIA 1ELZA 1AUKA 3M8ZA 1B8JA 3UNYA 1ALKA 3DYCA 3UO0A 1O99A 1N2LA 1KHNA 3NVLA 1E3CP 1HQAA 4FDJA 3T01A 3UN5A 1EJJA 1EW2A 1ZEDA 3T02A 3IGYB 1O98A 1URAA 3M8YA 1KH4A 3UN3A 3M7VA 3M8WA 2GLQA 3IGZB 4FDIA 1K7HA 1ZEFA 1KHJA 1Y7AA 3MK0A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1E1Z P;  3DPC A;  2G9Y A;  3UN2 A;  1P49 A;  3BDH A;  3CMR A;  3BDG B;  2ANH A;  3OT9 A;  1KH7 A;  3ED4 A;  1AJC A;  1EW8 A;  2GA3 A;  3SZZ A;  1ED9 A;  2QZU A;  3SZY A;  1ALI A;  1ALJ A;  1KHL A;  1ANJ A;  3BDF A;  1N2K A;  3MK2 A;  1AJD A;  1KH9 A;  1FSU A;  3TX0 A;  1ELX A;  1KH5 A;  1AJB A;  1SHQ A;  1KHK A;  3T00 A;  1E33 P;  1SHN A;  1ZEB A;  3BDG A;  1Y6V A;  1EW9 A;  1EI6 A;  1HJK A;  1URB A;  3TWZ A;  1E2S P;  1ED8 A;  1ALH A;  1AJA A;  3MK1 A;  2IFY A;  1ELY A;  1HDH A;  1EQJ A;  1ANI A;  1ELZ A;  1AUK A;  3M8Z A;  1B8J A;  3UNY A;  1ALK A;  3DYC A;  3UO0 A;  1O99 A;  1N2L A;  1KHN A;  3NVL A;  1E3C P;  1HQA A;  4FDJ A;  3T01 A;  3UN5 A;  1EJJ A;  1EW2 A;  1ZED A;  3T02 A;  3IGY B;  1O98 A;  1URA A;  3M8Y A;  1KH4 A;  3UN3 A;  3M7V A;  3M8W A;  2GLQ A;  3IGZ B;  4FDI A;  1K7H A;  1ZEF A;  1KHJ A;  1Y7A A;  3MK0 A; 
#chains in the KnotProt database with same CATH topology
 1E1Z P;  3DPC A;  2G9Y A;  3UN2 A;  1P49 A;  3BDH A;  3CMR A;  3BDG B;  2ANH A;  3OT9 A;  1KH7 A;  3ED4 A;  1AJC A;  1EW8 A;  2GA3 A;  3SZZ A;  1ED9 A;  2QZU A;  3SZY A;  1ALI A;  1ALJ A;  1KHL A;  1ANJ A;  3BDF A;  1N2K A;  3MK2 A;  1AJD A;  1KH9 A;  1FSU A;  3TX0 A;  1ELX A;  1KH5 A;  1AJB A;  1SHQ A;  1KHK A;  3T00 A;  1E33 P;  1SHN A;  1ZEB A;  3BDG A;  1Y6V A;  1EW9 A;  1EI6 A;  1HJK A;  1URB A;  3TWZ A;  1E2S P;  1ED8 A;  1ALH A;  1AJA A;  3MK1 A;  2IFY A;  1ELY A;  1HDH A;  1EQJ A;  1ANI A;  1ELZ A;  1AUK A;  3M8Z A;  1B8J A;  3UNY A;  1ALK A;  3DYC A;  3UO0 A;  1O99 A;  1N2L A;  1KHN A;  3NVL A;  1E3C P;  1HQA A;  4FDJ A;  3T01 A;  3UN5 A;  1EJJ A;  1EW2 A;  1ZED A;  3T02 A;  3IGY B;  1O98 A;  1URA A;  3M8Y A;  1KH4 A;  3UN3 A;  3M7V A;  3M8W A;  2GLQ A;  3IGZ B;  4FDI A;  1K7H A;  1ZEF A;  1KHJ A;  1Y7A A;  3MK0 A; 
#chains in the KnotProt database with same CATH homology
 1E1Z P;  3DPC A;  2G9Y A;  3UN2 A;  1P49 A;  3BDH A;  3CMR A;  3BDG B;  2ANH A;  3OT9 A;  1KH7 A;  3ED4 A;  1AJC A;  1EW8 A;  2GA3 A;  3SZZ A;  1ED9 A;  2QZU A;  3SZY A;  1ALI A;  1ALJ A;  1KHL A;  1ANJ A;  3BDF A;  1N2K A;  3MK2 A;  1AJD A;  1KH9 A;  1FSU A;  3TX0 A;  1ELX A;  1KH5 A;  1AJB A;  1SHQ A;  1KHK A;  3T00 A;  1E33 P;  1SHN A;  1ZEB A;  3BDG A;  1Y6V A;  1EW9 A;  1EI6 A;  1HJK A;  1URB A;  3TWZ A;  1E2S P;  1ED8 A;  1ALH A;  1AJA A;  3MK1 A;  2IFY A;  1ELY A;  1HDH A;  1EQJ A;  1ANI A;  1ELZ A;  1AUK A;  3M8Z A;  1B8J A;  3UNY A;  1ALK A;  3DYC A;  3UO0 A;  1O99 A;  1N2L A;  1KHN A;  3NVL A;  1E3C P;  1HQA A;  4FDJ A;  3T01 A;  3UN5 A;  1EJJ A;  1EW2 A;  1ZED A;  3T02 A;  3IGY B;  1O98 A;  1URA A;  3M8Y A;  1KH4 A;  3UN3 A;  3M7V A;  3M8W A;  2GLQ A;  3IGZ B;  4FDI A;  1K7H A;  1ZEF A;  1KHJ A;  1Y7A A;  3MK0 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling