3M8WA

Phosphopentomutase from bacillus cereus
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 7-328 322 1-6 343-391 329-342 6 49 slipknot
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDTMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 5-327 323 1-4 332-391 328-331 4 60 slipknot
view details
2.1 6-328 323 1-2, 335-391 3-5, 329-334 2 57 slipknot
view details
2.1 5-336 332 1-4 340-391 337-339 4 52 slipknot
view details
4.3m 6-339 334 1-5 342-391 340-341 5 50 slipknot
view details
2.1 5-341 337 1-4 345-391 342-344 4 47 slipknot
sequence length 391
structure length 391
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords Phosphopentomutase
source organism Bacillus cereus
total genus Genus: 140
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-03-19
KnotProt deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3m8wA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3m8wA01
3UN3A 3IGZB 1AUKA 1P49A 1EW2A 3TWZA 1FSUA 3UN5A 3T02A 1ED8A 1EI6A 1E3CP 1ALJA 1B8JA 1ELZA 1ALIA 1KHNA 3IGYB 1AJDA 1AJAA 1O99A 1E2SP 3UO0A 1N2LA 1Y7AA 1EQJA 1EW9A 3MK2A 1AJBA 4FDIA 3SZYA 1ZEDA 3M8YA 1SHNA 1E1ZP 3T01A 1HDHA 3DYCA 1ALHA 2ANHA 1KHJA 3OT9A 3ED4A 2QZUA 2IFYA 2GLQA 1ED9A 1ELXA 1KHKA 3NVLA 3UNYA 1KHLA 3UN2A 1ANJA 1KH4A 1Y6VA 1ZEBA 1URAA 3M8WA 1HJKA 1ELYA 1KH9A 3CMRA 1HQAA 1KH5A 1SHQA 3T00A 1EJJA 3SZZA 3M8ZA 1URBA 3M7VA 3TX0A 3MK1A 1ZEFA 3BDHA 3MK0A 1ALKA 3BDGB 4FDJA 1E33P 1K7HA 2G9YA 1ANIA 3BDGA 1N2KA 1EW8A 3BDFA 1KH7A 2GA3A 3DPCA 1O98A 1AJCA
chains in the KnotProt database with same CATH superfamily
3UN3A 3IGZB 1AUKA 1P49A 1EW2A 3TWZA 1FSUA 3UN5A 3T02A 1ED8A 1EI6A 1E3CP 1ALJA 1B8JA 1ELZA 1ALIA 1KHNA 3IGYB 1AJDA 1AJAA 1O99A 1E2SP 3UO0A 1N2LA 1Y7AA 1EQJA 1EW9A 3MK2A 1AJBA 4FDIA 3SZYA 1ZEDA 3M8YA 1SHNA 1E1ZP 3T01A 1HDHA 3DYCA 1ALHA 2ANHA 1KHJA 3OT9A 3ED4A 2QZUA 2IFYA 2GLQA 1ED9A 1ELXA 1KHKA 3NVLA 3UNYA 1KHLA 3UN2A 1ANJA 1KH4A 1Y6VA 1ZEBA 1URAA 3M8WA 1HJKA 1ELYA 1KH9A 3CMRA 1HQAA 1KH5A 1SHQA 3T00A 1EJJA 3SZZA 3M8ZA 1URBA 3M7VA 3TX0A 3MK1A 1ZEFA 3BDHA 3MK0A 1ALKA 3BDGB 4FDJA 1E33P 1K7HA 3D7SD 2G9YA 1ANIA 3BDGA 1N2KA 1EW8A 3BDFA 1KH7A 2GA3A 3DPCA 1O98A 1AJCA 3D7SB
chains in the KnotProt database with same CATH topology
3UN3A 3IGZB 1AUKA 1P49A 1EW2A 3TWZA 1FSUA 3UN5A 3T02A 1ED8A 1EI6A 1E3CP 1ALJA 1B8JA 1ELZA 1ALIA 1KHNA 3IGYB 1AJDA 1AJAA 1O99A 1E2SP 3UO0A 1N2LA 1Y7AA 1EQJA 1EW9A 3MK2A 1AJBA 4FDIA 3SZYA 1ZEDA 3M8YA 1SHNA 1E1ZP 3T01A 1HDHA 3DYCA 1ALHA 2ANHA 1KHJA 3OT9A 3ED4A 2QZUA 2IFYA 2GLQA 1ED9A 1ELXA 1KHKA 3NVLA 3UNYA 1KHLA 3UN2A 1ANJA 1KH4A 1Y6VA 1ZEBA 1URAA 3M8WA 1HJKA 1ELYA 1KH9A 3CMRA 1HQAA 1KH5A 1SHQA 3T00A 1EJJA 3SZZA 3M8ZA 1URBA 3M7VA 3TX0A 3MK1A 1ZEFA 3BDHA 3MK0A 1ALKA 3BDGB 4FDJA 1E33P 1K7HA 2G9YA 1ANIA 3BDGA 1N2KA 1EW8A 3BDFA 1KH7A 2GA3A 3DPCA 1O98A 1AJCA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3UN3 A;  3IGZ B;  1AUK A;  1P49 A;  1EW2 A;  3TWZ A;  1FSU A;  3UN5 A;  3T02 A;  1ED8 A;  1EI6 A;  1E3C P;  1ALJ A;  1B8J A;  1ELZ A;  1ALI A;  1KHN A;  3IGY B;  1AJD A;  1AJA A;  1O99 A;  1E2S P;  3UO0 A;  1N2L A;  1Y7A A;  1EQJ A;  1EW9 A;  3MK2 A;  1AJB A;  4FDI A;  3SZY A;  1ZED A;  3M8Y A;  1SHN A;  1E1Z P;  3T01 A;  1HDH A;  3DYC A;  1ALH A;  2ANH A;  1KHJ A;  3OT9 A;  3ED4 A;  2QZU A;  2IFY A;  2GLQ A;  1ED9 A;  1ELX A;  1KHK A;  3NVL A;  3UNY A;  1KHL A;  3UN2 A;  1ANJ A;  1KH4 A;  1Y6V A;  1ZEB A;  1URA A;  3M8W A;  1HJK A;  1ELY A;  1KH9 A;  3CMR A;  1HQA A;  1KH5 A;  1SHQ A;  3T00 A;  1EJJ A;  3SZZ A;  3M8Z A;  1URB A;  3M7V A;  3TX0 A;  3MK1 A;  1ZEF A;  3BDH A;  3MK0 A;  1ALK A;  3BDG B;  4FDJ A;  1E33 P;  1K7H A;  2G9Y A;  1ANI A;  3BDG A;  1N2K A;  1EW8 A;  3BDF A;  1KH7 A;  2GA3 A;  3DPC A;  1O98 A;  1AJC A; 
#chains in the KnotProt database with same CATH topology
 3UN3 A;  3IGZ B;  1AUK A;  1P49 A;  1EW2 A;  3TWZ A;  1FSU A;  3UN5 A;  3T02 A;  1ED8 A;  1EI6 A;  1E3C P;  1ALJ A;  1B8J A;  1ELZ A;  1ALI A;  1KHN A;  3IGY B;  1AJD A;  1AJA A;  1O99 A;  1E2S P;  3UO0 A;  1N2L A;  1Y7A A;  1EQJ A;  1EW9 A;  3MK2 A;  1AJB A;  4FDI A;  3SZY A;  1ZED A;  3M8Y A;  1SHN A;  1E1Z P;  3T01 A;  1HDH A;  3DYC A;  1ALH A;  2ANH A;  1KHJ A;  3OT9 A;  3ED4 A;  2QZU A;  2IFY A;  2GLQ A;  1ED9 A;  1ELX A;  1KHK A;  3NVL A;  3UNY A;  1KHL A;  3UN2 A;  1ANJ A;  1KH4 A;  1Y6V A;  1ZEB A;  1URA A;  3M8W A;  1HJK A;  1ELY A;  1KH9 A;  3CMR A;  1HQA A;  1KH5 A;  1SHQ A;  3T00 A;  1EJJ A;  3SZZ A;  3M8Z A;  1URB A;  3M7V A;  3TX0 A;  3MK1 A;  1ZEF A;  3BDH A;  3MK0 A;  1ALK A;  3BDG B;  4FDJ A;  1E33 P;  1K7H A;  3D7S D;  2G9Y A;  1ANI A;  3BDG A;  1N2K A;  1EW8 A;  3BDF A;  1KH7 A;  2GA3 A;  3DPC A;  1O98 A;  1AJC A;  3D7S B; 
#chains in the KnotProt database with same CATH homology
 3UN3 A;  3IGZ B;  1AUK A;  1P49 A;  1EW2 A;  3TWZ A;  1FSU A;  3UN5 A;  3T02 A;  1ED8 A;  1EI6 A;  1E3C P;  1ALJ A;  1B8J A;  1ELZ A;  1ALI A;  1KHN A;  3IGY B;  1AJD A;  1AJA A;  1O99 A;  1E2S P;  3UO0 A;  1N2L A;  1Y7A A;  1EQJ A;  1EW9 A;  3MK2 A;  1AJB A;  4FDI A;  3SZY A;  1ZED A;  3M8Y A;  1SHN A;  1E1Z P;  3T01 A;  1HDH A;  3DYC A;  1ALH A;  2ANH A;  1KHJ A;  3OT9 A;  3ED4 A;  2QZU A;  2IFY A;  2GLQ A;  1ED9 A;  1ELX A;  1KHK A;  3NVL A;  3UNY A;  1KHL A;  3UN2 A;  1ANJ A;  1KH4 A;  1Y6V A;  1ZEB A;  1URA A;  3M8W A;  1HJK A;  1ELY A;  1KH9 A;  3CMR A;  1HQA A;  1KH5 A;  1SHQ A;  3T00 A;  1EJJ A;  3SZZ A;  3M8Z A;  1URB A;  3M7V A;  3TX0 A;  3MK1 A;  1ZEF A;  3BDH A;  3MK0 A;  1ALK A;  3BDG B;  4FDJ A;  1E33 P;  1K7H A;  2G9Y A;  1ANI A;  3BDG A;  1N2K A;  1EW8 A;  3BDF A;  1KH7 A;  2GA3 A;  3DPC A;  1O98 A;  1AJC A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling