3TX0A

Unphosphorylated bacillus cereus phosphopentomutase in a p212121 crystal form
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 7-326 320 1-6 343-391 327-342 6 49 slipknot
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDTMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 4-335 332 1-3 341-391 336-340 3 51 slipknot
view details
2.1 7-327 321 1-3, 334-391 4-6, 328-333 3 58 slipknot
sequence length 391
structure length 391
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords Phosphopentomutase
source organism Bacillus cereus
total genus Genus: 143
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-09-22
KnotProt deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3tx0A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3tx0A01
1P49A 1ELXA 3TWZA 1ED8A 3T02A 1Y7AA 2G9YA 3ED4A 4FDIA 3DYCA 1EW9A 1HDHA 2IFYA 3BDFA 1ELZA 3M8ZA 1HQAA 1O99A 1AJCA 1ANJA 3MK2A 3UN2A 3M8YA 1ZEBA 2GLQA 4FDJA 1ED9A 3UN5A 1E33P 1FSUA 3UO0A 3DPCA 3NVLA 1KH4A 1URAA 1ZEDA 1KHKA 2ANHA 3BDHA 1O98A 1AJDA 1K7HA 2QZUA 3T00A 1ANIA 1SHQA 1ALKA 1ZEFA 3UNYA 3IGZB 3OT9A 1KH9A 1KHJA 1KH5A 1KHNA 1E2SP 1EI6A 3BDGA 1E1ZP 1EW8A 3TX0A 3IGYB 3CMRA 2GA3A 1AJAA 1EQJA 1AJBA 1ALIA 1KH7A 1AUKA 1ALHA 1ELYA 1HJKA 1SHNA 3M8WA 1B8JA 1URBA 1Y6VA 3SZZA 3UN3A 3T01A 1N2KA 3SZYA 3MK1A 1EJJA 1ALJA 3MK0A 3M7VA 3BDGB 1KHLA 1E3CP 1EW2A 1N2LA
chains in the KnotProt database with same CATH superfamily
1P49A 1ELXA 3TWZA 1ED8A 3T02A 1Y7AA 2G9YA 3ED4A 4FDIA 3DYCA 1EW9A 1HDHA 2IFYA 3BDFA 1ELZA 3M8ZA 1HQAA 1O99A 1AJCA 1ANJA 3MK2A 3UN2A 3D7SB 3M8YA 1ZEBA 2GLQA 4FDJA 1ED9A 3UN5A 1E33P 1FSUA 3UO0A 3DPCA 3NVLA 1KH4A 1URAA 1ZEDA 1KHKA 2ANHA 3BDHA 1O98A 1AJDA 1K7HA 2QZUA 3T00A 1ANIA 1SHQA 1ALKA 1ZEFA 3UNYA 3IGZB 3OT9A 1KH9A 1KHJA 1KH5A 1KHNA 1E2SP 1EI6A 3BDGA 1E1ZP 1EW8A 3TX0A 3IGYB 3D7SD 3CMRA 2GA3A 1AJAA 1EQJA 1AJBA 1ALIA 1KH7A 1AUKA 1ALHA 1ELYA 1HJKA 1SHNA 3M8WA 1B8JA 1URBA 1Y6VA 3SZZA 3UN3A 3T01A 1N2KA 3SZYA 3MK1A 1EJJA 1ALJA 3MK0A 3M7VA 3BDGB 1KHLA 1E3CP 1EW2A 1N2LA
chains in the KnotProt database with same CATH topology
1P49A 1ELXA 3TWZA 1ED8A 3T02A 1Y7AA 2G9YA 3ED4A 4FDIA 3DYCA 1EW9A 1HDHA 2IFYA 3BDFA 1ELZA 3M8ZA 1HQAA 1O99A 1AJCA 1ANJA 3MK2A 3UN2A 3M8YA 1ZEBA 2GLQA 4FDJA 1ED9A 3UN5A 1E33P 1FSUA 3UO0A 3DPCA 3NVLA 1KH4A 1URAA 1ZEDA 1KHKA 2ANHA 3BDHA 1O98A 1AJDA 1K7HA 2QZUA 3T00A 1ANIA 1SHQA 1ALKA 1ZEFA 3UNYA 3IGZB 3OT9A 1KH9A 1KHJA 1KH5A 1KHNA 1E2SP 1EI6A 3BDGA 1E1ZP 1EW8A 3TX0A 3IGYB 3CMRA 2GA3A 1AJAA 1EQJA 1AJBA 1ALIA 1KH7A 1AUKA 1ALHA 1ELYA 1HJKA 1SHNA 3M8WA 1B8JA 1URBA 1Y6VA 3SZZA 3UN3A 3T01A 1N2KA 3SZYA 3MK1A 1EJJA 1ALJA 3MK0A 3M7VA 3BDGB 1KHLA 1E3CP 1EW2A 1N2LA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1P49 A;  1ELX A;  3TWZ A;  1ED8 A;  3T02 A;  1Y7A A;  2G9Y A;  3ED4 A;  4FDI A;  3DYC A;  1EW9 A;  1HDH A;  2IFY A;  3BDF A;  1ELZ A;  3M8Z A;  1HQA A;  1O99 A;  1AJC A;  1ANJ A;  3MK2 A;  3UN2 A;  3M8Y A;  1ZEB A;  2GLQ A;  4FDJ A;  1ED9 A;  3UN5 A;  1E33 P;  1FSU A;  3UO0 A;  3DPC A;  3NVL A;  1KH4 A;  1URA A;  1ZED A;  1KHK A;  2ANH A;  3BDH A;  1O98 A;  1AJD A;  1K7H A;  2QZU A;  3T00 A;  1ANI A;  1SHQ A;  1ALK A;  1ZEF A;  3UNY A;  3IGZ B;  3OT9 A;  1KH9 A;  1KHJ A;  1KH5 A;  1KHN A;  1E2S P;  1EI6 A;  3BDG A;  1E1Z P;  1EW8 A;  3TX0 A;  3IGY B;  3CMR A;  2GA3 A;  1AJA A;  1EQJ A;  1AJB A;  1ALI A;  1KH7 A;  1AUK A;  1ALH A;  1ELY A;  1HJK A;  1SHN A;  3M8W A;  1B8J A;  1URB A;  1Y6V A;  3SZZ A;  3UN3 A;  3T01 A;  1N2K A;  3SZY A;  3MK1 A;  1EJJ A;  1ALJ A;  3MK0 A;  3M7V A;  3BDG B;  1KHL A;  1E3C P;  1EW2 A;  1N2L A; 
#chains in the KnotProt database with same CATH topology
 1P49 A;  1ELX A;  3TWZ A;  1ED8 A;  3T02 A;  1Y7A A;  2G9Y A;  3ED4 A;  4FDI A;  3DYC A;  1EW9 A;  1HDH A;  2IFY A;  3BDF A;  1ELZ A;  3M8Z A;  1HQA A;  1O99 A;  1AJC A;  1ANJ A;  3MK2 A;  3UN2 A;  3D7S B;  3M8Y A;  1ZEB A;  2GLQ A;  4FDJ A;  1ED9 A;  3UN5 A;  1E33 P;  1FSU A;  3UO0 A;  3DPC A;  3NVL A;  1KH4 A;  1URA A;  1ZED A;  1KHK A;  2ANH A;  3BDH A;  1O98 A;  1AJD A;  1K7H A;  2QZU A;  3T00 A;  1ANI A;  1SHQ A;  1ALK A;  1ZEF A;  3UNY A;  3IGZ B;  3OT9 A;  1KH9 A;  1KHJ A;  1KH5 A;  1KHN A;  1E2S P;  1EI6 A;  3BDG A;  1E1Z P;  1EW8 A;  3TX0 A;  3IGY B;  3D7S D;  3CMR A;  2GA3 A;  1AJA A;  1EQJ A;  1AJB A;  1ALI A;  1KH7 A;  1AUK A;  1ALH A;  1ELY A;  1HJK A;  1SHN A;  3M8W A;  1B8J A;  1URB A;  1Y6V A;  3SZZ A;  3UN3 A;  3T01 A;  1N2K A;  3SZY A;  3MK1 A;  1EJJ A;  1ALJ A;  3MK0 A;  3M7V A;  3BDG B;  1KHL A;  1E3C P;  1EW2 A;  1N2L A; 
#chains in the KnotProt database with same CATH homology
 1P49 A;  1ELX A;  3TWZ A;  1ED8 A;  3T02 A;  1Y7A A;  2G9Y A;  3ED4 A;  4FDI A;  3DYC A;  1EW9 A;  1HDH A;  2IFY A;  3BDF A;  1ELZ A;  3M8Z A;  1HQA A;  1O99 A;  1AJC A;  1ANJ A;  3MK2 A;  3UN2 A;  3M8Y A;  1ZEB A;  2GLQ A;  4FDJ A;  1ED9 A;  3UN5 A;  1E33 P;  1FSU A;  3UO0 A;  3DPC A;  3NVL A;  1KH4 A;  1URA A;  1ZED A;  1KHK A;  2ANH A;  3BDH A;  1O98 A;  1AJD A;  1K7H A;  2QZU A;  3T00 A;  1ANI A;  1SHQ A;  1ALK A;  1ZEF A;  3UNY A;  3IGZ B;  3OT9 A;  1KH9 A;  1KHJ A;  1KH5 A;  1KHN A;  1E2S P;  1EI6 A;  3BDG A;  1E1Z P;  1EW8 A;  3TX0 A;  3IGY B;  3CMR A;  2GA3 A;  1AJA A;  1EQJ A;  1AJB A;  1ALI A;  1KH7 A;  1AUK A;  1ALH A;  1ELY A;  1HJK A;  1SHN A;  3M8W A;  1B8J A;  1URB A;  1Y6V A;  3SZZ A;  3UN3 A;  3T01 A;  1N2K A;  3SZY A;  3MK1 A;  1EJJ A;  1ALJ A;  3MK0 A;  3M7V A;  3BDG B;  1KHL A;  1E3C P;  1EW2 A;  1N2L A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling