3T00A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with vanadate
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 25-247 223 1-24 383-413 248-382 24 31 slipknot
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 24-247 224 1-23 263-413 248-262 23 151 slipknot
view details
3.1 25-248 224 1-24 338-413 249-337 24 76 slipknot
view details
3.1 25-337 313 1-24 382-413 338-381 24 32 slipknot
view details
2.1 26-320 295 1-24, 328-413 25-25, 321-327 24 86 slipknot
view details
2.1 26-328 303 1-24, 337-413 25-25, 329-336 24 77 slipknot
sequence length 413
structure length 413
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords phosphonoacetate hydrolase
source organism Sinorhizobium meliloti
total genus Genus: 130
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19
KnotProt deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t00A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t00A01
1ELYA 1ALKA 2GLQA 1SHQA 3M8YA 3BDGB 1EW9A 2IFYA 1AJDA 1ED9A 3T01A 1ZEFA 1ALIA 3UN5A 1ED8A 1ANJA 3UNYA 2ANHA 3BDFA 1KH9A 1ZEBA 1EW2A 3T02A 1HQAA 3TWZA 1P49A 3MK0A 1EJJA 1FSUA 1KH5A 3IGYB 1Y6VA 1B8JA 1ELXA 1AJAA 1AJCA 3SZZA 1E2SP 3IGZB 1HJKA 1O99A 3BDGA 3TX0A 1ELZA 2G9YA 1E1ZP 2QZUA 1N2LA 1HDHA 1URAA 1SHNA 3DPCA 1EW8A 3NVLA 3DYCA 4FDIA 3ED4A 3MK1A 3UN2A 3SZYA 3CMRA 1ANIA 1E3CP 1ZEDA 3M7VA 3BDHA 1Y7AA 3OT9A 1AUKA 1KH7A 1EI6A 3T00A 1KHLA 1N2KA 1KHJA 4FDJA 1AJBA 3M8WA 1ALJA 3UN3A 2GA3A 1K7HA 1URBA 1EQJA 1KHKA 3UO0A 1O98A 3M8ZA 3MK2A 1KHNA 1KH4A 1E33P
chains in the KnotProt database with same CATH superfamily
1ELYA 1ALKA 2GLQA 1SHQA 3M8YA 3BDGB 1EW9A 2IFYA 1AJDA 1ED9A 3T01A 1ZEFA 1ALIA 3UN5A 1ED8A 1ANJA 3UNYA 2ANHA 3BDFA 1KH9A 1ZEBA 1EW2A 3T02A 1HQAA 3TWZA 1P49A 3MK0A 1EJJA 1FSUA 1KH5A 3IGYB 1Y6VA 1B8JA 1ELXA 1AJAA 1AJCA 3SZZA 1E2SP 3IGZB 1HJKA 1O99A 3BDGA 3TX0A 1ELZA 2G9YA 1E1ZP 2QZUA 1N2LA 1HDHA 1URAA 1SHNA 3DPCA 1EW8A 3NVLA 3DYCA 4FDIA 3ED4A 3MK1A 3UN2A 3SZYA 3CMRA 1ANIA 1E3CP 1ZEDA 3M7VA 3BDHA 1Y7AA 3OT9A 1AUKA 1KH7A 1EI6A 3T00A 1KHLA 1N2KA 1KHJA 4FDJA 1AJBA 3M8WA 1ALJA 3UN3A 2GA3A 1K7HA 1URBA 1EQJA 1KHKA 3UO0A 1O98A 3M8ZA 3MK2A 1KHNA 1KH4A 1E33P
chains in the KnotProt database with same CATH topology
1ELYA 1ALKA 2GLQA 1SHQA 3M8YA 3BDGB 1EW9A 2IFYA 1AJDA 1ED9A 3T01A 1ZEFA 1ALIA 3UN5A 1ED8A 1ANJA 3UNYA 2ANHA 3BDFA 1KH9A 1ZEBA 1EW2A 3T02A 1HQAA 3TWZA 1P49A 3MK0A 1EJJA 1FSUA 1KH5A 3IGYB 1Y6VA 1B8JA 1ELXA 1AJAA 1AJCA 3SZZA 1E2SP 3IGZB 1HJKA 1O99A 3BDGA 3TX0A 1ELZA 2G9YA 1E1ZP 2QZUA 1N2LA 1HDHA 1URAA 1SHNA 3DPCA 1EW8A 3NVLA 3DYCA 4FDIA 3ED4A 3MK1A 3UN2A 3SZYA 3CMRA 1ANIA 1E3CP 1ZEDA 3M7VA 3BDHA 1Y7AA 3OT9A 1AUKA 1KH7A 1EI6A 3T00A 1KHLA 1N2KA 1KHJA 4FDJA 1AJBA 3M8WA 1ALJA 3UN3A 2GA3A 1K7HA 1URBA 1EQJA 1KHKA 3UO0A 1O98A 3M8ZA 3MK2A 1KHNA 1KH4A 1E33P
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1ELY A;  1ALK A;  2GLQ A;  1SHQ A;  3M8Y A;  3BDG B;  1EW9 A;  2IFY A;  1AJD A;  1ED9 A;  3T01 A;  1ZEF A;  1ALI A;  3UN5 A;  1ED8 A;  1ANJ A;  3UNY A;  2ANH A;  3BDF A;  1KH9 A;  1ZEB A;  1EW2 A;  3T02 A;  1HQA A;  3TWZ A;  1P49 A;  3MK0 A;  1EJJ A;  1FSU A;  1KH5 A;  3IGY B;  1Y6V A;  1B8J A;  1ELX A;  1AJA A;  1AJC A;  3SZZ A;  1E2S P;  3IGZ B;  1HJK A;  1O99 A;  3BDG A;  3TX0 A;  1ELZ A;  2G9Y A;  1E1Z P;  2QZU A;  1N2L A;  1HDH A;  1URA A;  1SHN A;  3DPC A;  1EW8 A;  3NVL A;  3DYC A;  4FDI A;  3ED4 A;  3MK1 A;  3UN2 A;  3SZY A;  3CMR A;  1ANI A;  1E3C P;  1ZED A;  3M7V A;  3BDH A;  1Y7A A;  3OT9 A;  1AUK A;  1KH7 A;  1EI6 A;  3T00 A;  1KHL A;  1N2K A;  1KHJ A;  4FDJ A;  1AJB A;  3M8W A;  1ALJ A;  3UN3 A;  2GA3 A;  1K7H A;  1URB A;  1EQJ A;  1KHK A;  3UO0 A;  1O98 A;  3M8Z A;  3MK2 A;  1KHN A;  1KH4 A;  1E33 P; 
#chains in the KnotProt database with same CATH topology
 1ELY A;  1ALK A;  2GLQ A;  1SHQ A;  3M8Y A;  3BDG B;  1EW9 A;  2IFY A;  1AJD A;  1ED9 A;  3T01 A;  1ZEF A;  1ALI A;  3UN5 A;  1ED8 A;  1ANJ A;  3UNY A;  2ANH A;  3BDF A;  1KH9 A;  1ZEB A;  1EW2 A;  3T02 A;  1HQA A;  3TWZ A;  1P49 A;  3MK0 A;  1EJJ A;  1FSU A;  1KH5 A;  3IGY B;  1Y6V A;  1B8J A;  1ELX A;  1AJA A;  1AJC A;  3SZZ A;  1E2S P;  3IGZ B;  1HJK A;  1O99 A;  3BDG A;  3TX0 A;  1ELZ A;  2G9Y A;  1E1Z P;  2QZU A;  1N2L A;  1HDH A;  1URA A;  1SHN A;  3DPC A;  1EW8 A;  3NVL A;  3DYC A;  4FDI A;  3ED4 A;  3MK1 A;  3UN2 A;  3SZY A;  3CMR A;  1ANI A;  1E3C P;  1ZED A;  3M7V A;  3BDH A;  1Y7A A;  3OT9 A;  1AUK A;  1KH7 A;  1EI6 A;  3T00 A;  1KHL A;  1N2K A;  1KHJ A;  4FDJ A;  1AJB A;  3M8W A;  1ALJ A;  3UN3 A;  2GA3 A;  1K7H A;  1URB A;  1EQJ A;  1KHK A;  3UO0 A;  1O98 A;  3M8Z A;  3MK2 A;  1KHN A;  1KH4 A;  1E33 P; 
#chains in the KnotProt database with same CATH homology
 1ELY A;  1ALK A;  2GLQ A;  1SHQ A;  3M8Y A;  3BDG B;  1EW9 A;  2IFY A;  1AJD A;  1ED9 A;  3T01 A;  1ZEF A;  1ALI A;  3UN5 A;  1ED8 A;  1ANJ A;  3UNY A;  2ANH A;  3BDF A;  1KH9 A;  1ZEB A;  1EW2 A;  3T02 A;  1HQA A;  3TWZ A;  1P49 A;  3MK0 A;  1EJJ A;  1FSU A;  1KH5 A;  3IGY B;  1Y6V A;  1B8J A;  1ELX A;  1AJA A;  1AJC A;  3SZZ A;  1E2S P;  3IGZ B;  1HJK A;  1O99 A;  3BDG A;  3TX0 A;  1ELZ A;  2G9Y A;  1E1Z P;  2QZU A;  1N2L A;  1HDH A;  1URA A;  1SHN A;  3DPC A;  1EW8 A;  3NVL A;  3DYC A;  4FDI A;  3ED4 A;  3MK1 A;  3UN2 A;  3SZY A;  3CMR A;  1ANI A;  1E3C P;  1ZED A;  3M7V A;  3BDH A;  1Y7A A;  3OT9 A;  1AUK A;  1KH7 A;  1EI6 A;  3T00 A;  1KHL A;  1N2K A;  1KHJ A;  4FDJ A;  1AJB A;  3M8W A;  1ALJ A;  3UN3 A;  2GA3 A;  1K7H A;  1URB A;  1EQJ A;  1KHK A;  3UO0 A;  1O98 A;  3M8Z A;  3MK2 A;  1KHN A;  1KH4 A;  1E33 P; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling