1B8JA

Alkaline phosphatase complexed with vanadate
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 46-369 324 1-45 420-449 370-419 45 30 slipknot
Chain Sequence
TPEMPVLENRAAQGDITAPGGARRLTGDQTAALRDSLSDKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDYVTDXAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAGEWQGKTLREQAQARGYQLVSDAASLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKEGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 47-373 327 1-46 412-449 374-411 46 38 slipknot
view details
3.1 45-411 367 1-44 421-449 412-420 44 29 slipknot
view details
2.1 26-367 342 1-11, 373-449 12-25, 368-372 11 77 slipknot
view details
2.1 45-367 323 1-30, 373-449 31-44, 368-372 30 77 slipknot
sequence length 449
structure length 449
publication title A model of the transition state in the alkaline phosphatase reaction.
pubmed doi rcsb
molecule tags Alkaline phosphatase
molecule keywords PROTEIN (ALKALINE PHOSPHATASE)
source organism Escherichia coli
total genus Genus: 163
ec nomenclature ec 3.1.3.1: Alkaline phosphatase.
pdb deposition date 1999-02-01
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00245 Alk_phosphatase Alkaline phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1b8jA00
1ALJA 1ALIA 3SZZA 3MK0A 1O99A 1URBA 2GLQA 3BDFA 3M8YA 1ZEFA 3IGZB 1E2SP 3TWZA 1ANJA 1KH4A 1EQJA 1E3CP 3UN5A 3TX0A 1EW9A 1ZEDA 3CMRA 3SZYA 3M7VA 1EW2A 2QZUA 1E1ZP 1K7HA 1AJAA 3BDGA 2GA3A 3BDGB 1N2KA 3DPCA 3UO0A 3MK2A 1HQAA 3NVLA 1SHQA 1N2LA 2G9YA 3M8ZA 1FSUA 1ELYA 2ANHA 4FDIA 1URAA 1EJJA 3BDHA 3MK1A 1AUKA 1KHJA 1ELZA 1AJCA 1Y6VA 1AJBA 3M8WA 3T01A 1KH7A 1SHNA 1KHLA 1O98A 1ED8A 3T02A 1HJKA 1ALKA 1Y7AA 1KH5A 1KHKA 1ANIA 1AJDA 4FDJA 1ZEBA 2IFYA 3ED4A 1ELXA 1E33P 3UNYA 3OT9A 3UN2A 1ED9A 1HDHA 3T00A 1KH9A 3DYCA 3UN3A 1EI6A 1KHNA 3IGYB 1P49A 1B8JA 1EW8A
chains in the KnotProt database with same CATH superfamily
1ALJA 1ALIA 3SZZA 3MK0A 1O99A 1URBA 2GLQA 3BDFA 3M8YA 1ZEFA 3IGZB 1E2SP 3TWZA 1ANJA 1KH4A 1EQJA 1E3CP 3UN5A 3TX0A 1EW9A 1ZEDA 3CMRA 3SZYA 3M7VA 1EW2A 2QZUA 1E1ZP 1K7HA 1AJAA 3BDGA 2GA3A 3BDGB 1N2KA 3DPCA 3UO0A 3MK2A 1HQAA 3NVLA 1SHQA 1N2LA 2G9YA 3M8ZA 1FSUA 1ELYA 2ANHA 4FDIA 1URAA 1EJJA 3BDHA 3MK1A 1AUKA 1KHJA 1ELZA 1AJCA 1Y6VA 1AJBA 3M8WA 3T01A 1KH7A 1SHNA 1KHLA 1O98A 1ED8A 3T02A 1HJKA 1ALKA 1Y7AA 1KH5A 1KHKA 1ANIA 1AJDA 4FDJA 1ZEBA 2IFYA 3ED4A 1ELXA 1E33P 3UNYA 3OT9A 3UN2A 1ED9A 1HDHA 3T00A 1KH9A 3DYCA 3UN3A 1EI6A 1KHNA 3IGYB 1P49A 1B8JA 1EW8A
chains in the KnotProt database with same CATH topology
1ALJA 1ALIA 3SZZA 3MK0A 1O99A 1URBA 2GLQA 3BDFA 3M8YA 1ZEFA 3IGZB 1E2SP 3TWZA 1ANJA 1KH4A 1EQJA 1E3CP 3UN5A 3TX0A 1EW9A 1ZEDA 3CMRA 3SZYA 3M7VA 1EW2A 2QZUA 1E1ZP 1K7HA 1AJAA 3BDGA 2GA3A 3BDGB 1N2KA 3DPCA 3UO0A 3MK2A 1HQAA 3NVLA 1SHQA 1N2LA 2G9YA 3M8ZA 1FSUA 1ELYA 2ANHA 4FDIA 1URAA 1EJJA 3BDHA 3MK1A 1AUKA 1KHJA 1ELZA 1AJCA 1Y6VA 1AJBA 3M8WA 3T01A 1KH7A 1SHNA 1KHLA 1O98A 1ED8A 3T02A 1HJKA 1ALKA 1Y7AA 1KH5A 1KHKA 1ANIA 1AJDA 4FDJA 1ZEBA 2IFYA 3ED4A 1ELXA 1E33P 3UNYA 3OT9A 3UN2A 1ED9A 1HDHA 3T00A 1KH9A 3DYCA 3UN3A 1EI6A 1KHNA 3IGYB 1P49A 1B8JA 1EW8A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1ALJ A;  1ALI A;  3SZZ A;  3MK0 A;  1O99 A;  1URB A;  2GLQ A;  3BDF A;  3M8Y A;  1ZEF A;  3IGZ B;  1E2S P;  3TWZ A;  1ANJ A;  1KH4 A;  1EQJ A;  1E3C P;  3UN5 A;  3TX0 A;  1EW9 A;  1ZED A;  3CMR A;  3SZY A;  3M7V A;  1EW2 A;  2QZU A;  1E1Z P;  1K7H A;  1AJA A;  3BDG A;  2GA3 A;  3BDG B;  1N2K A;  3DPC A;  3UO0 A;  3MK2 A;  1HQA A;  3NVL A;  1SHQ A;  1N2L A;  2G9Y A;  3M8Z A;  1FSU A;  1ELY A;  2ANH A;  4FDI A;  1URA A;  1EJJ A;  3BDH A;  3MK1 A;  1AUK A;  1KHJ A;  1ELZ A;  1AJC A;  1Y6V A;  1AJB A;  3M8W A;  3T01 A;  1KH7 A;  1SHN A;  1KHL A;  1O98 A;  1ED8 A;  3T02 A;  1HJK A;  1ALK A;  1Y7A A;  1KH5 A;  1KHK A;  1ANI A;  1AJD A;  4FDJ A;  1ZEB A;  2IFY A;  3ED4 A;  1ELX A;  1E33 P;  3UNY A;  3OT9 A;  3UN2 A;  1ED9 A;  1HDH A;  3T00 A;  1KH9 A;  3DYC A;  3UN3 A;  1EI6 A;  1KHN A;  3IGY B;  1P49 A;  1B8J A;  1EW8 A; 
#chains in the KnotProt database with same CATH topology
 1ALJ A;  1ALI A;  3SZZ A;  3MK0 A;  1O99 A;  1URB A;  2GLQ A;  3BDF A;  3M8Y A;  1ZEF A;  3IGZ B;  1E2S P;  3TWZ A;  1ANJ A;  1KH4 A;  1EQJ A;  1E3C P;  3UN5 A;  3TX0 A;  1EW9 A;  1ZED A;  3CMR A;  3SZY A;  3M7V A;  1EW2 A;  2QZU A;  1E1Z P;  1K7H A;  1AJA A;  3BDG A;  2GA3 A;  3BDG B;  1N2K A;  3DPC A;  3UO0 A;  3MK2 A;  1HQA A;  3NVL A;  1SHQ A;  1N2L A;  2G9Y A;  3M8Z A;  1FSU A;  1ELY A;  2ANH A;  4FDI A;  1URA A;  1EJJ A;  3BDH A;  3MK1 A;  1AUK A;  1KHJ A;  1ELZ A;  1AJC A;  1Y6V A;  1AJB A;  3M8W A;  3T01 A;  1KH7 A;  1SHN A;  1KHL A;  1O98 A;  1ED8 A;  3T02 A;  1HJK A;  1ALK A;  1Y7A A;  1KH5 A;  1KHK A;  1ANI A;  1AJD A;  4FDJ A;  1ZEB A;  2IFY A;  3ED4 A;  1ELX A;  1E33 P;  3UNY A;  3OT9 A;  3UN2 A;  1ED9 A;  1HDH A;  3T00 A;  1KH9 A;  3DYC A;  3UN3 A;  1EI6 A;  1KHN A;  3IGY B;  1P49 A;  1B8J A;  1EW8 A; 
#chains in the KnotProt database with same CATH homology
 1ALJ A;  1ALI A;  3SZZ A;  3MK0 A;  1O99 A;  1URB A;  2GLQ A;  3BDF A;  3M8Y A;  1ZEF A;  3IGZ B;  1E2S P;  3TWZ A;  1ANJ A;  1KH4 A;  1EQJ A;  1E3C P;  3UN5 A;  3TX0 A;  1EW9 A;  1ZED A;  3CMR A;  3SZY A;  3M7V A;  1EW2 A;  2QZU A;  1E1Z P;  1K7H A;  1AJA A;  3BDG A;  2GA3 A;  3BDG B;  1N2K A;  3DPC A;  3UO0 A;  3MK2 A;  1HQA A;  3NVL A;  1SHQ A;  1N2L A;  2G9Y A;  3M8Z A;  1FSU A;  1ELY A;  2ANH A;  4FDI A;  1URA A;  1EJJ A;  3BDH A;  3MK1 A;  1AUK A;  1KHJ A;  1ELZ A;  1AJC A;  1Y6V A;  1AJB A;  3M8W A;  3T01 A;  1KH7 A;  1SHN A;  1KHL A;  1O98 A;  1ED8 A;  3T02 A;  1HJK A;  1ALK A;  1Y7A A;  1KH5 A;  1KHK A;  1ANI A;  1AJD A;  4FDJ A;  1ZEB A;  2IFY A;  3ED4 A;  1ELX A;  1E33 P;  3UNY A;  3OT9 A;  3UN2 A;  1ED9 A;  1HDH A;  3T00 A;  1KH9 A;  3DYC A;  3UN3 A;  1EI6 A;  1KHN A;  3IGY B;  1P49 A;  1B8J A;  1EW8 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling