1E33P

Crystal structure of an arylsulfatase a mutant p426l
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 7-263 257 1-6 294-485 264-293 6 192 slipknot
Chain Sequence
RPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLXTPSRAALLTGRLPVRMGMYPGVLVPSSRGGLPLEEVTVAEVLAARGYLTGMAGKWHLGVGPEGAFLPPHQGFHRFLGIPYSHDQGPCQNLTCFPPATPCDGGCDQGLVPIPLLANLSVEAQPPWLPGLEARYMAFAHDLMADAQREDRPFFLYYASHHTHYPQFSGQSFAERSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIFTADNGPETMRMSRGGCSGLLRCGKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPLPNVTLDGFDLSPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSLTAHEPLLLYDLSKDPGENYNLLG----ATPEVLQALKQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 5-261 257 1-4 267-481 262-266 4 215 slipknot
view details
3.1 7-266 260 1-6 294-481 267-293 6 188 slipknot
view details
3.1 6-293 288 1-5 295-481 294-294 5 187 slipknot
view details
2.1 6-294 289 1-5 296-481 295-295 5 186 slipknot
sequence length 485
structure length 481
publication title Defective Oligomerization of Arylsulfatase a as a Cause of its Instability in Lysosomes and Metachromatic Leukodystrophy.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ARYLSULFATASE A
missing residues 426-429
total genus Genus: 153
ec nomenclature ec 3.1.6.8: Cerebroside-sulfatase.
pdb deposition date 2000-06-06
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.10 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 1e33P02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1e33P01
1AUKA 3T00A 1EI6A 1ZEDA 1EJJA 3SZYA 3DPCA 1URAA 2QZUA 3M8WA 1HJKA 3MK1A 3UN3A 2IFYA 2GLQA 3UNYA 1ELZA 1K7HA 1HQAA 1EW8A 1B8JA 3BDFA 3SZZA 1ALJA 1E2SP 1ELXA 1Y6VA 3UN2A 3CMRA 3UN5A 1E3CP 1KHJA 1ED9A 3BDGA 1AJAA 1N2KA 1ANJA 3T01A 1ALIA 1O98A 3DYCA 1ANIA 1ED8A 1O99A 1ALKA 3M7VA 1AJBA 2GA3A 1KHNA 1FSUA 1AJCA 3BDGB 3IGYB 3T02A 1ZEFA 1SHQA 3M8YA 1KH7A 1KHKA 1KH5A 1ELYA 1ZEBA 1P49A 2G9YA 1E1ZP 2ANHA 1Y7AA 3UO0A 1EW9A 3MK0A 4FDJA 3TX0A 4FDIA 1KHLA 3M8ZA 1KH4A 3OT9A 3IGZB 3MK2A 1N2LA 1HDHA 1SHNA 3TWZA 1E33P 1KH9A 1EW2A 3ED4A 1URBA 1AJDA 3NVLA 1EQJA 3BDHA
chains in the KnotProt database with same CATH superfamily
1AUKA 3T00A 1EI6A 1ZEDA 1EJJA 3SZYA 3DPCA 1URAA 2QZUA 3M8WA 1HJKA 3MK1A 3UN3A 2IFYA 2GLQA 3UNYA 1ELZA 1K7HA 1HQAA 1EW8A 1B8JA 3BDFA 3SZZA 1ALJA 1E2SP 1ELXA 1Y6VA 3UN2A 3CMRA 3UN5A 1E3CP 1KHJA 1ED9A 3BDGA 1AJAA 1N2KA 1ANJA 3T01A 1ALIA 1O98A 3DYCA 1ANIA 1ED8A 1O99A 1ALKA 3M7VA 1AJBA 2GA3A 1KHNA 1FSUA 1AJCA 3BDGB 3IGYB 3T02A 1ZEFA 1SHQA 3M8YA 1KH7A 1KHKA 1KH5A 1ELYA 1ZEBA 1P49A 2G9YA 1E1ZP 2ANHA 1Y7AA 3UO0A 1EW9A 3MK0A 4FDJA 3TX0A 4FDIA 1KHLA 3M8ZA 1KH4A 3OT9A 3IGZB 3MK2A 1N2LA 1HDHA 1SHNA 3TWZA 1E33P 1KH9A 1EW2A 3ED4A 1URBA 1AJDA 3NVLA 1EQJA 3BDHA
chains in the KnotProt database with same CATH topology
1AUKA 3T00A 1EI6A 1ZEDA 1EJJA 3SZYA 3DPCA 1URAA 2QZUA 3M8WA 1HJKA 3MK1A 3UN3A 2IFYA 2GLQA 3UNYA 1ELZA 1K7HA 1HQAA 1EW8A 1B8JA 3BDFA 3SZZA 1ALJA 1E2SP 1ELXA 1Y6VA 3UN2A 3CMRA 3UN5A 1E3CP 1KHJA 1ED9A 3BDGA 1AJAA 1N2KA 1ANJA 3T01A 1ALIA 1O98A 3DYCA 1ANIA 1ED8A 1O99A 1ALKA 3M7VA 1AJBA 2GA3A 1KHNA 1FSUA 1AJCA 3BDGB 3IGYB 3T02A 1ZEFA 1SHQA 3M8YA 1KH7A 1KHKA 1KH5A 1ELYA 1ZEBA 1P49A 2G9YA 1E1ZP 2ANHA 1Y7AA 3UO0A 1EW9A 3MK0A 4FDJA 3TX0A 4FDIA 1KHLA 3M8ZA 1KH4A 3OT9A 3IGZB 3MK2A 1N2LA 1HDHA 1SHNA 3TWZA 1E33P 1KH9A 1EW2A 3ED4A 1URBA 1AJDA 3NVLA 1EQJA 3BDHA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1AUK A;  3T00 A;  1EI6 A;  1ZED A;  1EJJ A;  3SZY A;  3DPC A;  1URA A;  2QZU A;  3M8W A;  1HJK A;  3MK1 A;  3UN3 A;  2IFY A;  2GLQ A;  3UNY A;  1ELZ A;  1K7H A;  1HQA A;  1EW8 A;  1B8J A;  3BDF A;  3SZZ A;  1ALJ A;  1E2S P;  1ELX A;  1Y6V A;  3UN2 A;  3CMR A;  3UN5 A;  1E3C P;  1KHJ A;  1ED9 A;  3BDG A;  1AJA A;  1N2K A;  1ANJ A;  3T01 A;  1ALI A;  1O98 A;  3DYC A;  1ANI A;  1ED8 A;  1O99 A;  1ALK A;  3M7V A;  1AJB A;  2GA3 A;  1KHN A;  1FSU A;  1AJC A;  3BDG B;  3IGY B;  3T02 A;  1ZEF A;  1SHQ A;  3M8Y A;  1KH7 A;  1KHK A;  1KH5 A;  1ELY A;  1ZEB A;  1P49 A;  2G9Y A;  1E1Z P;  2ANH A;  1Y7A A;  3UO0 A;  1EW9 A;  3MK0 A;  4FDJ A;  3TX0 A;  4FDI A;  1KHL A;  3M8Z A;  1KH4 A;  3OT9 A;  3IGZ B;  3MK2 A;  1N2L A;  1HDH A;  1SHN A;  3TWZ A;  1E33 P;  1KH9 A;  1EW2 A;  3ED4 A;  1URB A;  1AJD A;  3NVL A;  1EQJ A;  3BDH A; 
#chains in the KnotProt database with same CATH topology
 1AUK A;  3T00 A;  1EI6 A;  1ZED A;  1EJJ A;  3SZY A;  3DPC A;  1URA A;  2QZU A;  3M8W A;  1HJK A;  3MK1 A;  3UN3 A;  2IFY A;  2GLQ A;  3UNY A;  1ELZ A;  1K7H A;  1HQA A;  1EW8 A;  1B8J A;  3BDF A;  3SZZ A;  1ALJ A;  1E2S P;  1ELX A;  1Y6V A;  3UN2 A;  3CMR A;  3UN5 A;  1E3C P;  1KHJ A;  1ED9 A;  3BDG A;  1AJA A;  1N2K A;  1ANJ A;  3T01 A;  1ALI A;  1O98 A;  3DYC A;  1ANI A;  1ED8 A;  1O99 A;  1ALK A;  3M7V A;  1AJB A;  2GA3 A;  1KHN A;  1FSU A;  1AJC A;  3BDG B;  3IGY B;  3T02 A;  1ZEF A;  1SHQ A;  3M8Y A;  1KH7 A;  1KHK A;  1KH5 A;  1ELY A;  1ZEB A;  1P49 A;  2G9Y A;  1E1Z P;  2ANH A;  1Y7A A;  3UO0 A;  1EW9 A;  3MK0 A;  4FDJ A;  3TX0 A;  4FDI A;  1KHL A;  3M8Z A;  1KH4 A;  3OT9 A;  3IGZ B;  3MK2 A;  1N2L A;  1HDH A;  1SHN A;  3TWZ A;  1E33 P;  1KH9 A;  1EW2 A;  3ED4 A;  1URB A;  1AJD A;  3NVL A;  1EQJ A;  3BDH A; 
#chains in the KnotProt database with same CATH homology
 1AUK A;  3T00 A;  1EI6 A;  1ZED A;  1EJJ A;  3SZY A;  3DPC A;  1URA A;  2QZU A;  3M8W A;  1HJK A;  3MK1 A;  3UN3 A;  2IFY A;  2GLQ A;  3UNY A;  1ELZ A;  1K7H A;  1HQA A;  1EW8 A;  1B8J A;  3BDF A;  3SZZ A;  1ALJ A;  1E2S P;  1ELX A;  1Y6V A;  3UN2 A;  3CMR A;  3UN5 A;  1E3C P;  1KHJ A;  1ED9 A;  3BDG A;  1AJA A;  1N2K A;  1ANJ A;  3T01 A;  1ALI A;  1O98 A;  3DYC A;  1ANI A;  1ED8 A;  1O99 A;  1ALK A;  3M7V A;  1AJB A;  2GA3 A;  1KHN A;  1FSU A;  1AJC A;  3BDG B;  3IGY B;  3T02 A;  1ZEF A;  1SHQ A;  3M8Y A;  1KH7 A;  1KHK A;  1KH5 A;  1ELY A;  1ZEB A;  1P49 A;  2G9Y A;  1E1Z P;  2ANH A;  1Y7A A;  3UO0 A;  1EW9 A;  3MK0 A;  4FDJ A;  3TX0 A;  4FDI A;  1KHL A;  3M8Z A;  1KH4 A;  3OT9 A;  3IGZ B;  3MK2 A;  1N2L A;  1HDH A;  1SHN A;  3TWZ A;  1E33 P;  1KH9 A;  1EW2 A;  3ED4 A;  1URB A;  1AJD A;  3NVL A;  1EQJ A;  3BDH A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling