| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 24-240 | 217 | 1-23 | 376-406 | 241-375 | 23 | 31 | slipknot |
Chain Sequence |
TNLISVNSRSYRLSSAPTIVICVDGCEQEYINQAIQAGQAPFLAELTGFGTVLTGDCVVPSFTNPNNLSIVTGAPPSVHGICGNFFFDQETQEEVLMNDAKYLRAPTILAEMAKAGQLVAVVTAKDKLRNLLGHQLKGICFSAEKADQVNLEEHGVENILARVGMPVPSVYSADLSEFVFAAGLSLLTNERPDFMYLSTTDYVQHKHAPGTPEANAFYAMMDSYFKRYHEQGAIVAITADHGMNAKTDAIGRPNILFLQDLLDAQYGAQRTRVLLPITDPYVVHHGALGSYATVYLRDAVPQRDAIDFLAGIAGVEAVLTRSQACQRFELPEDRIGDLVVLGERLTVLGSAADKHDLSGLTVPLRSHGGVSEQKVPLIFNRKLVGLD--GRLRNFDIIDLALNHLA
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 22-240 | 219 | 1-21 | 368-404 | 241-367 | 21 | 37 | slipknot | ||
| view details |
|
3.1 | 22-367 | 346 | 1-21 | 372-404 | 368-371 | 21 | 33 | slipknot | ||
| view details |
|
3.1 | 21-371 | 351 | 1-20 | 374-404 | 372-373 | 20 | 31 | slipknot |
| sequence length |
406
|
| structure length |
404
|
| publication title |
Crystal structure of Phosphonoacetate Hydrolase complexed with phosphonoformate
rcsb |
| molecule tags |
Hydrolase
|
| molecule keywords |
PHOSPHONOACETATE HYDROLASE
|
| source organism |
Pseudomonas fluorescens
|
| missing residues |
388-389
|
| total genus |
 Genus: 126
|
| ec nomenclature |
ec
3.11.1.2: Phosphonoacetate hydrolase. |
| pdb deposition date | 2000-02-24 |
| KnotProt deposition date | 2014-07-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01663 | Phosphodiest | Type I phosphodiesterase / nucleotide pyrophosphatase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Gyrase A; domain 2 | Domain 2, Phosphonoacetate Hydrolase | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Alkaline Phosphatase, subunit A | Alkaline Phosphatase, subunit A |
#chains in the KnotProt database with same CATH superfamily 1E1Z P; 1HQA A; 1AJA A; 1ED8 A; 1ALI A; 1ANI A; 1EW8 A; 1ZED A; 1ELZ A; 2ANH A; 1ELY A; 1KHN A; 1B8J A; 3TX0 A; 3CMR A; 1ELX A; 3M8Z A; 1SHN A; 1ZEB A; 3MK0 A; 3UN2 A; 2G9Y A; 2IFY A; 1EW9 A; 1K7H A; 3NVL A; 1N2L A; 4FDJ A; 1URA A; 3ED4 A; 1SHQ A; 1AJD A; 1EI6 A; 1URB A; 3OT9 A; 1KH5 A; 1ALK A; 3M8W A; 1FSU A; 1KHL A; 2GA3 A; 1AUK A; 3T01 A; 1O98 A; 3SZZ A; 3TWZ A; 1KH9 A; 1AJC A; 3IGY B; 1E3C P; 1N2K A; 1HDH A; 1ZEF A; 3BDH A; 1P49 A; 1EW2 A; 1Y7A A; 1EJJ A; 2GLQ A; 1KHK A; 1E33 P; 3MK2 A; 3BDF A; 1KH4 A; 3DPC A; 3MK1 A; 3UNY A; 3SZY A; 3M7V A; 3T02 A; 1EQJ A; 1KH7 A; 3M8Y A; 4FDI A; 3UO0 A; 1ANJ A; 1KHJ A; 1Y6V A; 3BDG B; 2QZU A; 3UN5 A; 1ED9 A; 1E2S P; 3T00 A; 3IGZ B; 3UN3 A; 3DYC A; 1HJK A; 3BDG A; 1ALJ A; 1AJB A; 1O99 A; #chains in the KnotProt database with same CATH topology 1E1Z P; 1HQA A; 1AJA A; 1ED8 A; 1ALI A; 1ANI A; 1EW8 A; 1ZED A; 1ELZ A; 2ANH A; 1ELY A; 1KHN A; 1B8J A; 3TX0 A; 3CMR A; 1ELX A; 3M8Z A; 1SHN A; 1ZEB A; 3MK0 A; 3UN2 A; 2G9Y A; 2IFY A; 1EW9 A; 1K7H A; 3NVL A; 1N2L A; 4FDJ A; 1URA A; 3ED4 A; 1SHQ A; 1AJD A; 1EI6 A; 1URB A; 3OT9 A; 1KH5 A; 1ALK A; 3M8W A; 1FSU A; 1KHL A; 2GA3 A; 1AUK A; 3T01 A; 1O98 A; 3SZZ A; 3TWZ A; 1KH9 A; 1AJC A; 3IGY B; 1E3C P; 1N2K A; 1HDH A; 1ZEF A; 3BDH A; 1P49 A; 1EW2 A; 1Y7A A; 1EJJ A; 2GLQ A; 1KHK A; 1E33 P; 3MK2 A; 3BDF A; 1KH4 A; 3DPC A; 3MK1 A; 3UNY A; 3SZY A; 3M7V A; 3T02 A; 1EQJ A; 1KH7 A; 3M8Y A; 4FDI A; 3UO0 A; 1ANJ A; 1KHJ A; 1Y6V A; 3BDG B; 2QZU A; 3UN5 A; 1ED9 A; 1E2S P; 3T00 A; 3IGZ B; 3UN3 A; 3DYC A; 1HJK A; 3BDG A; 1ALJ A; 1AJB A; 1O99 A; #chains in the KnotProt database with same CATH homology 1E1Z P; 1HQA A; 1AJA A; 1ED8 A; 1ALI A; 1ANI A; 1EW8 A; 1ZED A; 1ELZ A; 2ANH A; 1ELY A; 1KHN A; 1B8J A; 3TX0 A; 3CMR A; 1ELX A; 3M8Z A; 1SHN A; 1ZEB A; 3MK0 A; 3UN2 A; 2G9Y A; 2IFY A; 1EW9 A; 1K7H A; 3NVL A; 1N2L A; 4FDJ A; 1URA A; 3ED4 A; 1SHQ A; 1AJD A; 1EI6 A; 1URB A; 3OT9 A; 1KH5 A; 1ALK A; 3M8W A; 1FSU A; 1KHL A; 2GA3 A; 1AUK A; 3T01 A; 1O98 A; 3SZZ A; 3TWZ A; 1KH9 A; 1AJC A; 3IGY B; 1E3C P; 1N2K A; 1HDH A; 1ZEF A; 3BDH A; 1P49 A; 1EW2 A; 1Y7A A; 1EJJ A; 2GLQ A; 1KHK A; 1E33 P; 3MK2 A; 3BDF A; 1KH4 A; 3DPC A; 3MK1 A; 3UNY A; 3SZY A; 3M7V A; 3T02 A; 1EQJ A; 1KH7 A; 3M8Y A; 4FDI A; 3UO0 A; 1ANJ A; 1KHJ A; 1Y6V A; 3BDG B; 2QZU A; 3UN5 A; 1ED9 A; 1E2S P; 3T00 A; 3IGZ B; 3UN3 A; 3DYC A; 1HJK A; 3BDG A; 1ALJ A; 1AJB A; 1O99 A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
