1EI6A

Crystal structure of phosphonoacetate hydrolase complexed with phosphonoformate
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 24-240 217 1-23 376-406 241-375 23 31 slipknot
Chain Sequence
TNLISVNSRSYRLSSAPTIVICVDGCEQEYINQAIQAGQAPFLAELTGFGTVLTGDCVVPSFTNPNNLSIVTGAPPSVHGICGNFFFDQETQEEVLMNDAKYLRAPTILAEMAKAGQLVAVVTAKDKLRNLLGHQLKGICFSAEKADQVNLEEHGVENILARVGMPVPSVYSADLSEFVFAAGLSLLTNERPDFMYLSTTDYVQHKHAPGTPEANAFYAMMDSYFKRYHEQGAIVAITADHGMNAKTDAIGRPNILFLQDLLDAQYGAQRTRVLLPITDPYVVHHGALGSYATVYLRDAVPQRDAIDFLAGIAGVEAVLTRSQACQRFELPEDRIGDLVVLGERLTVLGSAADKHDLSGLTVPLRSHGGVSEQKVPLIFNRKLVGLD--GRLRNFDIIDLALNHLA
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 22-240 219 1-21 368-404 241-367 21 37 slipknot
view details
3.1 22-367 346 1-21 372-404 368-371 21 33 slipknot
view details
3.1 21-371 351 1-20 374-404 372-373 20 31 slipknot
sequence length 406
structure length 404
publication title Crystal structure of Phosphonoacetate Hydrolase complexed with phosphonoformate
rcsb
molecule tags Hydrolase
molecule keywords PHOSPHONOACETATE HYDROLASE
source organism Pseudomonas fluorescens
missing residues 388-389
total genus Genus: 126
ec nomenclature ec 3.11.1.2: Phosphonoacetate hydrolase.
pdb deposition date 2000-02-24
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 1ei6A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1ei6A01
1ALJA 1ALIA 3SZZA 3MK0A 1O99A 1URBA 2GLQA 3BDFA 3M8YA 1ZEFA 3IGZB 1E2SP 3TWZA 1ANJA 1KH4A 1EQJA 1E3CP 3UN5A 3TX0A 1EW9A 1ZEDA 3CMRA 3SZYA 3M7VA 1EW2A 2QZUA 1E1ZP 1K7HA 1AJAA 3BDGA 2GA3A 3BDGB 1N2KA 3DPCA 3UO0A 3MK2A 1HQAA 3NVLA 1SHQA 1N2LA 2G9YA 3M8ZA 1FSUA 1ELYA 2ANHA 4FDIA 1URAA 1EJJA 3BDHA 3MK1A 1AUKA 1KHJA 1ELZA 1AJCA 1Y6VA 1AJBA 3M8WA 3T01A 1KH7A 1SHNA 1KHLA 1O98A 1ED8A 3T02A 1HJKA 1ALKA 1Y7AA 1KH5A 1KHKA 1ANIA 1AJDA 4FDJA 1ZEBA 2IFYA 3ED4A 1ELXA 1E33P 3UNYA 3OT9A 3UN2A 1ED9A 1HDHA 3T00A 1KH9A 3DYCA 3UN3A 1EI6A 1KHNA 3IGYB 1P49A 1B8JA 1EW8A
chains in the KnotProt database with same CATH superfamily
1ALJA 1ALIA 3SZZA 3MK0A 1O99A 1URBA 2GLQA 3BDFA 3M8YA 1ZEFA 3IGZB 1E2SP 3TWZA 1ANJA 1KH4A 1EQJA 1E3CP 3UN5A 3TX0A 1EW9A 1ZEDA 3CMRA 3SZYA 3M7VA 1EW2A 2QZUA 1E1ZP 1K7HA 1AJAA 3BDGA 2GA3A 3BDGB 1N2KA 3DPCA 3UO0A 3MK2A 1HQAA 3NVLA 1SHQA 1N2LA 2G9YA 3M8ZA 1FSUA 1ELYA 2ANHA 4FDIA 1URAA 1EJJA 3BDHA 3MK1A 1AUKA 1KHJA 1ELZA 1AJCA 1Y6VA 1AJBA 3M8WA 3T01A 1KH7A 1SHNA 1KHLA 1O98A 1ED8A 3T02A 1HJKA 1ALKA 1Y7AA 1KH5A 1KHKA 1ANIA 1AJDA 4FDJA 1ZEBA 2IFYA 3ED4A 1ELXA 1E33P 3UNYA 3OT9A 3UN2A 1ED9A 1HDHA 3T00A 1KH9A 3DYCA 3UN3A 1EI6A 1KHNA 3IGYB 1P49A 1B8JA 1EW8A
chains in the KnotProt database with same CATH topology
1ALJA 1ALIA 3SZZA 3MK0A 1O99A 1URBA 2GLQA 3BDFA 3M8YA 1ZEFA 3IGZB 1E2SP 3TWZA 1ANJA 1KH4A 1EQJA 1E3CP 3UN5A 3TX0A 1EW9A 1ZEDA 3CMRA 3SZYA 3M7VA 1EW2A 2QZUA 1E1ZP 1K7HA 1AJAA 3BDGA 2GA3A 3BDGB 1N2KA 3DPCA 3UO0A 3MK2A 1HQAA 3NVLA 1SHQA 1N2LA 2G9YA 3M8ZA 1FSUA 1ELYA 2ANHA 4FDIA 1URAA 1EJJA 3BDHA 3MK1A 1AUKA 1KHJA 1ELZA 1AJCA 1Y6VA 1AJBA 3M8WA 3T01A 1KH7A 1SHNA 1KHLA 1O98A 1ED8A 3T02A 1HJKA 1ALKA 1Y7AA 1KH5A 1KHKA 1ANIA 1AJDA 4FDJA 1ZEBA 2IFYA 3ED4A 1ELXA 1E33P 3UNYA 3OT9A 3UN2A 1ED9A 1HDHA 3T00A 1KH9A 3DYCA 3UN3A 1EI6A 1KHNA 3IGYB 1P49A 1B8JA 1EW8A
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1ALJ A;  1ALI A;  3SZZ A;  3MK0 A;  1O99 A;  1URB A;  2GLQ A;  3BDF A;  3M8Y A;  1ZEF A;  3IGZ B;  1E2S P;  3TWZ A;  1ANJ A;  1KH4 A;  1EQJ A;  1E3C P;  3UN5 A;  3TX0 A;  1EW9 A;  1ZED A;  3CMR A;  3SZY A;  3M7V A;  1EW2 A;  2QZU A;  1E1Z P;  1K7H A;  1AJA A;  3BDG A;  2GA3 A;  3BDG B;  1N2K A;  3DPC A;  3UO0 A;  3MK2 A;  1HQA A;  3NVL A;  1SHQ A;  1N2L A;  2G9Y A;  3M8Z A;  1FSU A;  1ELY A;  2ANH A;  4FDI A;  1URA A;  1EJJ A;  3BDH A;  3MK1 A;  1AUK A;  1KHJ A;  1ELZ A;  1AJC A;  1Y6V A;  1AJB A;  3M8W A;  3T01 A;  1KH7 A;  1SHN A;  1KHL A;  1O98 A;  1ED8 A;  3T02 A;  1HJK A;  1ALK A;  1Y7A A;  1KH5 A;  1KHK A;  1ANI A;  1AJD A;  4FDJ A;  1ZEB A;  2IFY A;  3ED4 A;  1ELX A;  1E33 P;  3UNY A;  3OT9 A;  3UN2 A;  1ED9 A;  1HDH A;  3T00 A;  1KH9 A;  3DYC A;  3UN3 A;  1EI6 A;  1KHN A;  3IGY B;  1P49 A;  1B8J A;  1EW8 A; 
#chains in the KnotProt database with same CATH topology
 1ALJ A;  1ALI A;  3SZZ A;  3MK0 A;  1O99 A;  1URB A;  2GLQ A;  3BDF A;  3M8Y A;  1ZEF A;  3IGZ B;  1E2S P;  3TWZ A;  1ANJ A;  1KH4 A;  1EQJ A;  1E3C P;  3UN5 A;  3TX0 A;  1EW9 A;  1ZED A;  3CMR A;  3SZY A;  3M7V A;  1EW2 A;  2QZU A;  1E1Z P;  1K7H A;  1AJA A;  3BDG A;  2GA3 A;  3BDG B;  1N2K A;  3DPC A;  3UO0 A;  3MK2 A;  1HQA A;  3NVL A;  1SHQ A;  1N2L A;  2G9Y A;  3M8Z A;  1FSU A;  1ELY A;  2ANH A;  4FDI A;  1URA A;  1EJJ A;  3BDH A;  3MK1 A;  1AUK A;  1KHJ A;  1ELZ A;  1AJC A;  1Y6V A;  1AJB A;  3M8W A;  3T01 A;  1KH7 A;  1SHN A;  1KHL A;  1O98 A;  1ED8 A;  3T02 A;  1HJK A;  1ALK A;  1Y7A A;  1KH5 A;  1KHK A;  1ANI A;  1AJD A;  4FDJ A;  1ZEB A;  2IFY A;  3ED4 A;  1ELX A;  1E33 P;  3UNY A;  3OT9 A;  3UN2 A;  1ED9 A;  1HDH A;  3T00 A;  1KH9 A;  3DYC A;  3UN3 A;  1EI6 A;  1KHN A;  3IGY B;  1P49 A;  1B8J A;  1EW8 A; 
#chains in the KnotProt database with same CATH homology
 1ALJ A;  1ALI A;  3SZZ A;  3MK0 A;  1O99 A;  1URB A;  2GLQ A;  3BDF A;  3M8Y A;  1ZEF A;  3IGZ B;  1E2S P;  3TWZ A;  1ANJ A;  1KH4 A;  1EQJ A;  1E3C P;  3UN5 A;  3TX0 A;  1EW9 A;  1ZED A;  3CMR A;  3SZY A;  3M7V A;  1EW2 A;  2QZU A;  1E1Z P;  1K7H A;  1AJA A;  3BDG A;  2GA3 A;  3BDG B;  1N2K A;  3DPC A;  3UO0 A;  3MK2 A;  1HQA A;  3NVL A;  1SHQ A;  1N2L A;  2G9Y A;  3M8Z A;  1FSU A;  1ELY A;  2ANH A;  4FDI A;  1URA A;  1EJJ A;  3BDH A;  3MK1 A;  1AUK A;  1KHJ A;  1ELZ A;  1AJC A;  1Y6V A;  1AJB A;  3M8W A;  3T01 A;  1KH7 A;  1SHN A;  1KHL A;  1O98 A;  1ED8 A;  3T02 A;  1HJK A;  1ALK A;  1Y7A A;  1KH5 A;  1KHK A;  1ANI A;  1AJD A;  4FDJ A;  1ZEB A;  2IFY A;  3ED4 A;  1ELX A;  1E33 P;  3UNY A;  3OT9 A;  3UN2 A;  1ED9 A;  1HDH A;  3T00 A;  1KH9 A;  3DYC A;  3UN3 A;  1EI6 A;  1KHN A;  3IGY B;  1P49 A;  1B8J A;  1EW8 A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling