3SZZA

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with acetate
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 25-247 223 1-24 383-413 248-382 24 31 slipknot
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 9-245 237 1-8 251-413 246-250 8 163 slipknot
view details
2.1 13-247 235 1-12 253-413 248-252 12 161 slipknot
view details
3.1 24-248 225 1-23 382-413 249-381 23 32 slipknot
view details
2.1 19-381 363 1-18 384-413 382-383 18 30 slipknot
view details
2.1 18-383 366 1-1, 385-413 2-17, 384-384 1 29 slipknot
view details
3.1 22-247 226 1-12, 249-413 13-21, 248-248 12 165 slipknot
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
structure length 413
molecule tags Hydrolase
source organism Sinorhizobium meliloti
sequence length 413
total genus Genus: 127
molecule keywords phosphonoacetate hydrolase
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19
KnotProt deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3szzA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3szzA01
1EW8A 1ZEDA 1KHLA 1ED9A 4FDJA 1ANIA 2QZUA 1EI6A 1EW2A 3UNYA 3MK0A 1KHKA 3BDFA 3T02A 1ALKA 1K7HA 1O98A 1Y7AA 1KH5A 3UN2A 1E33P 3OT9A 2ANHA 1AJBA 1N2KA 3UN5A 3T01A 1E1ZP 3M7VA 2GA3A 3M8ZA 1N2LA 3SZZA 3TWZA 1ANJA 3M8WA 1FSUA 1ALHA 1EQJA 3MK2A 1ZEFA 3UN3A 3NVLA 1URAA 1AJCA 3CMRA 1ELXA 2G9YA 3T00A 1Y6VA 3IGZB 3TX0A 3UO0A 3SZYA 2GLQA 1AUKA 1ZEBA 1KHNA 1B8JA 1HDHA 4FDIA 1EJJA 3DYCA 1HJKA 1ALIA 1EW9A 1ED8A 1HQAA 1KH7A 1P49A 3DPCA 3ED4A 1URBA 1AJDA 3IGYB 3MK1A 1ELYA 1KHJA 3BDGA 1E3CP 1ALJA 1O99A 1KH4A 1E2SP 3BDHA 1SHQA 1SHNA 1AJAA 1ELZA 2IFYA 3M8YA 1KH9A 3BDGB
chains in the KnotProt database with same CATH superfamily
1EW8A 1ZEDA 1KHLA 1ED9A 4FDJA 1ANIA 2QZUA 1EI6A 1EW2A 3UNYA 3MK0A 1KHKA 3BDFA 3T02A 1ALKA 1K7HA 1O98A 1Y7AA 1KH5A 3UN2A 1E33P 3OT9A 2ANHA 1AJBA 1N2KA 3UN5A 3T01A 1E1ZP 3M7VA 2GA3A 3M8ZA 1N2LA 3SZZA 3TWZA 1ANJA 3M8WA 1FSUA 1ALHA 1EQJA 3MK2A 1ZEFA 3UN3A 3NVLA 1URAA 1AJCA 3CMRA 1ELXA 2G9YA 3T00A 1Y6VA 3IGZB 3TX0A 3UO0A 3SZYA 2GLQA 1AUKA 1ZEBA 1KHNA 1B8JA 1HDHA 4FDIA 1EJJA 3DYCA 1HJKA 1ALIA 1EW9A 1ED8A 1HQAA 1KH7A 1P49A 3DPCA 3ED4A 1URBA 1AJDA 3IGYB 3MK1A 1ELYA 1KHJA 3BDGA 1E3CP 1ALJA 1O99A 1KH4A 1E2SP 3BDHA 1SHQA 1SHNA 1AJAA 1ELZA 2IFYA 3M8YA 1KH9A 3BDGB
chains in the KnotProt database with same CATH topology
1EW8A 1ZEDA 1KHLA 1ED9A 4FDJA 1ANIA 2QZUA 1EI6A 1EW2A 3UNYA 3MK0A 1KHKA 3BDFA 3T02A 1ALKA 1K7HA 1O98A 1Y7AA 1KH5A 3UN2A 1E33P 3OT9A 2ANHA 1AJBA 1N2KA 3UN5A 3T01A 1E1ZP 3M7VA 2GA3A 3M8ZA 1N2LA 3SZZA 3TWZA 1ANJA 3M8WA 1FSUA 1ALHA 1EQJA 3MK2A 1ZEFA 3UN3A 3NVLA 1URAA 1AJCA 3CMRA 1ELXA 2G9YA 3T00A 1Y6VA 3IGZB 3TX0A 3UO0A 3SZYA 2GLQA 1AUKA 1ZEBA 1KHNA 1B8JA 1HDHA 4FDIA 1EJJA 3DYCA 1HJKA 1ALIA 1EW9A 1ED8A 1HQAA 1KH7A 1P49A 3DPCA 3ED4A 1URBA 1AJDA 3IGYB 3MK1A 1ELYA 1KHJA 3BDGA 1E3CP 1ALJA 1O99A 1KH4A 1E2SP 3BDHA 1SHQA 1SHNA 1AJAA 1ELZA 2IFYA 3M8YA 1KH9A 3BDGB
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1EW8 A;  1ZED A;  1KHL A;  1ED9 A;  4FDJ A;  1ANI A;  2QZU A;  1EI6 A;  1EW2 A;  3UNY A;  3MK0 A;  1KHK A;  3BDF A;  3T02 A;  1ALK A;  1K7H A;  1O98 A;  1Y7A A;  1KH5 A;  3UN2 A;  1E33 P;  3OT9 A;  2ANH A;  1AJB A;  1N2K A;  3UN5 A;  3T01 A;  1E1Z P;  3M7V A;  2GA3 A;  3M8Z A;  1N2L A;  3SZZ A;  3TWZ A;  1ANJ A;  3M8W A;  1FSU A;  1ALH A;  1EQJ A;  3MK2 A;  1ZEF A;  3UN3 A;  3NVL A;  1URA A;  1AJC A;  3CMR A;  1ELX A;  2G9Y A;  3T00 A;  1Y6V A;  3IGZ B;  3TX0 A;  3UO0 A;  3SZY A;  2GLQ A;  1AUK A;  1ZEB A;  1KHN A;  1B8J A;  1HDH A;  4FDI A;  1EJJ A;  3DYC A;  1HJK A;  1ALI A;  1EW9 A;  1ED8 A;  1HQA A;  1KH7 A;  1P49 A;  3DPC A;  3ED4 A;  1URB A;  1AJD A;  3IGY B;  3MK1 A;  1ELY A;  1KHJ A;  3BDG A;  1E3C P;  1ALJ A;  1O99 A;  1KH4 A;  1E2S P;  3BDH A;  1SHQ A;  1SHN A;  1AJA A;  1ELZ A;  2IFY A;  3M8Y A;  1KH9 A;  3BDG B; 
#chains in the KnotProt database with same CATH topology
 1EW8 A;  1ZED A;  1KHL A;  1ED9 A;  4FDJ A;  1ANI A;  2QZU A;  1EI6 A;  1EW2 A;  3UNY A;  3MK0 A;  1KHK A;  3BDF A;  3T02 A;  1ALK A;  1K7H A;  1O98 A;  1Y7A A;  1KH5 A;  3UN2 A;  1E33 P;  3OT9 A;  2ANH A;  1AJB A;  1N2K A;  3UN5 A;  3T01 A;  1E1Z P;  3M7V A;  2GA3 A;  3M8Z A;  1N2L A;  3SZZ A;  3TWZ A;  1ANJ A;  3M8W A;  1FSU A;  1ALH A;  1EQJ A;  3MK2 A;  1ZEF A;  3UN3 A;  3NVL A;  1URA A;  1AJC A;  3CMR A;  1ELX A;  2G9Y A;  3T00 A;  1Y6V A;  3IGZ B;  3TX0 A;  3UO0 A;  3SZY A;  2GLQ A;  1AUK A;  1ZEB A;  1KHN A;  1B8J A;  1HDH A;  4FDI A;  1EJJ A;  3DYC A;  1HJK A;  1ALI A;  1EW9 A;  1ED8 A;  1HQA A;  1KH7 A;  1P49 A;  3DPC A;  3ED4 A;  1URB A;  1AJD A;  3IGY B;  3MK1 A;  1ELY A;  1KHJ A;  3BDG A;  1E3C P;  1ALJ A;  1O99 A;  1KH4 A;  1E2S P;  3BDH A;  1SHQ A;  1SHN A;  1AJA A;  1ELZ A;  2IFY A;  3M8Y A;  1KH9 A;  3BDG B; 
#chains in the KnotProt database with same CATH homology
 1EW8 A;  1ZED A;  1KHL A;  1ED9 A;  4FDJ A;  1ANI A;  2QZU A;  1EI6 A;  1EW2 A;  3UNY A;  3MK0 A;  1KHK A;  3BDF A;  3T02 A;  1ALK A;  1K7H A;  1O98 A;  1Y7A A;  1KH5 A;  3UN2 A;  1E33 P;  3OT9 A;  2ANH A;  1AJB A;  1N2K A;  3UN5 A;  3T01 A;  1E1Z P;  3M7V A;  2GA3 A;  3M8Z A;  1N2L A;  3SZZ A;  3TWZ A;  1ANJ A;  3M8W A;  1FSU A;  1ALH A;  1EQJ A;  3MK2 A;  1ZEF A;  3UN3 A;  3NVL A;  1URA A;  1AJC A;  3CMR A;  1ELX A;  2G9Y A;  3T00 A;  1Y6V A;  3IGZ B;  3TX0 A;  3UO0 A;  3SZY A;  2GLQ A;  1AUK A;  1ZEB A;  1KHN A;  1B8J A;  1HDH A;  4FDI A;  1EJJ A;  3DYC A;  1HJK A;  1ALI A;  1EW9 A;  1ED8 A;  1HQA A;  1KH7 A;  1P49 A;  3DPC A;  3ED4 A;  1URB A;  1AJD A;  3IGY B;  3MK1 A;  1ELY A;  1KHJ A;  3BDG A;  1E3C P;  1ALJ A;  1O99 A;  1KH4 A;  1E2S P;  3BDH A;  1SHQ A;  1SHN A;  1AJA A;  1ELZ A;  2IFY A;  3M8Y A;  1KH9 A;  3BDG B; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling