3M8YA

Phosphopentomutase from bacillus cereus after glucose-1,6-bisphosphate activation
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 7-328 322 1-6 343-391 329-342 6 49 slipknot
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDTMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 5-326 322 1-4 330-391 327-329 4 62 slipknot
view details
3.1 6-331 326 1-5 339-391 332-338 5 53 slipknot
view details
3.1 6-338 333 1-5 345-391 339-344 5 47 slipknot
sequence length 391
structure length 391
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords Phosphopentomutase
source organism Bacillus cereus
total genus Genus: 143
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-03-19
KnotProt deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3m8yA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3m8yA01
1ELXA 1EJJA 3UNYA 4FDJA 3MK2A 1KHLA 1URAA 1EI6A 1KH9A 1E3CP 1ALKA 3M8ZA 1ALIA 1ZEFA 1ED8A 3MK0A 3BDGA 3MK1A 1AJAA 1E33P 3M8YA 3SZYA 2GA3A 1HDHA 1P49A 1AJDA 1SHNA 3T00A 1KH7A 3BDHA 3M7VA 3BDGB 1SHQA 1AUKA 1EQJA 3IGZB 1URBA 3NVLA 3UO0A 1B8JA 1EW8A 3T01A 1AJBA 2ANHA 1ALJA 2GLQA 1ED9A 1FSUA 1KHNA 3OT9A 1EW2A 1E2SP 1HQAA 1O98A 3TX0A 2G9YA 3UN5A 3T02A 3UN2A 1ELYA 4FDIA 3TWZA 1ZEDA 3BDFA 1HJKA 1Y6VA 1ZEBA 1E1ZP 1ANIA 3CMRA 1KHJA 1K7HA 1KH5A 3IGYB 3DPCA 1KH4A 1N2LA 1AJCA 1O99A 3UN3A 3M8WA 3ED4A 1EW9A 2IFYA 1KHKA 2QZUA 1N2KA 1ALHA 1Y7AA 3DYCA 1ELZA 1ANJA 3SZZA
chains in the KnotProt database with same CATH superfamily
1ELXA 1EJJA 3UNYA 4FDJA 3MK2A 1KHLA 1URAA 1EI6A 1KH9A 1E3CP 1ALKA 3M8ZA 1ALIA 1ZEFA 1ED8A 3MK0A 3BDGA 3MK1A 1AJAA 1E33P 3M8YA 3SZYA 2GA3A 1HDHA 1P49A 1AJDA 1SHNA 3T00A 1KH7A 3BDHA 3M7VA 3BDGB 1SHQA 1AUKA 1EQJA 3IGZB 1URBA 3NVLA 3UO0A 1B8JA 1EW8A 3T01A 1AJBA 3D7SB 2ANHA 1ALJA 2GLQA 1ED9A 1FSUA 1KHNA 3OT9A 1EW2A 1E2SP 1HQAA 1O98A 3TX0A 2G9YA 3UN5A 3T02A 3UN2A 1ELYA 4FDIA 3TWZA 1ZEDA 3BDFA 1HJKA 1Y6VA 1ZEBA 1E1ZP 1ANIA 3CMRA 1KHJA 1K7HA 1KH5A 3IGYB 3DPCA 1KH4A 1N2LA 1AJCA 1O99A 3UN3A 3M8WA 3ED4A 1EW9A 2IFYA 1KHKA 2QZUA 1N2KA 1ALHA 1Y7AA 3DYCA 1ELZA 1ANJA 3SZZA 3D7SD
chains in the KnotProt database with same CATH topology
1ELXA 1EJJA 3UNYA 4FDJA 3MK2A 1KHLA 1URAA 1EI6A 1KH9A 1E3CP 1ALKA 3M8ZA 1ALIA 1ZEFA 1ED8A 3MK0A 3BDGA 3MK1A 1AJAA 1E33P 3M8YA 3SZYA 2GA3A 1HDHA 1P49A 1AJDA 1SHNA 3T00A 1KH7A 3BDHA 3M7VA 3BDGB 1SHQA 1AUKA 1EQJA 3IGZB 1URBA 3NVLA 3UO0A 1B8JA 1EW8A 3T01A 1AJBA 2ANHA 1ALJA 2GLQA 1ED9A 1FSUA 1KHNA 3OT9A 1EW2A 1E2SP 1HQAA 1O98A 3TX0A 2G9YA 3UN5A 3T02A 3UN2A 1ELYA 4FDIA 3TWZA 1ZEDA 3BDFA 1HJKA 1Y6VA 1ZEBA 1E1ZP 1ANIA 3CMRA 1KHJA 1K7HA 1KH5A 3IGYB 3DPCA 1KH4A 1N2LA 1AJCA 1O99A 3UN3A 3M8WA 3ED4A 1EW9A 2IFYA 1KHKA 2QZUA 1N2KA 1ALHA 1Y7AA 3DYCA 1ELZA 1ANJA 3SZZA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1ELX A;  1EJJ A;  3UNY A;  4FDJ A;  3MK2 A;  1KHL A;  1URA A;  1EI6 A;  1KH9 A;  1E3C P;  1ALK A;  3M8Z A;  1ALI A;  1ZEF A;  1ED8 A;  3MK0 A;  3BDG A;  3MK1 A;  1AJA A;  1E33 P;  3M8Y A;  3SZY A;  2GA3 A;  1HDH A;  1P49 A;  1AJD A;  1SHN A;  3T00 A;  1KH7 A;  3BDH A;  3M7V A;  3BDG B;  1SHQ A;  1AUK A;  1EQJ A;  3IGZ B;  1URB A;  3NVL A;  3UO0 A;  1B8J A;  1EW8 A;  3T01 A;  1AJB A;  2ANH A;  1ALJ A;  2GLQ A;  1ED9 A;  1FSU A;  1KHN A;  3OT9 A;  1EW2 A;  1E2S P;  1HQA A;  1O98 A;  3TX0 A;  2G9Y A;  3UN5 A;  3T02 A;  3UN2 A;  1ELY A;  4FDI A;  3TWZ A;  1ZED A;  3BDF A;  1HJK A;  1Y6V A;  1ZEB A;  1E1Z P;  1ANI A;  3CMR A;  1KHJ A;  1K7H A;  1KH5 A;  3IGY B;  3DPC A;  1KH4 A;  1N2L A;  1AJC A;  1O99 A;  3UN3 A;  3M8W A;  3ED4 A;  1EW9 A;  2IFY A;  1KHK A;  2QZU A;  1N2K A;  1ALH A;  1Y7A A;  3DYC A;  1ELZ A;  1ANJ A;  3SZZ A; 
#chains in the KnotProt database with same CATH topology
 1ELX A;  1EJJ A;  3UNY A;  4FDJ A;  3MK2 A;  1KHL A;  1URA A;  1EI6 A;  1KH9 A;  1E3C P;  1ALK A;  3M8Z A;  1ALI A;  1ZEF A;  1ED8 A;  3MK0 A;  3BDG A;  3MK1 A;  1AJA A;  1E33 P;  3M8Y A;  3SZY A;  2GA3 A;  1HDH A;  1P49 A;  1AJD A;  1SHN A;  3T00 A;  1KH7 A;  3BDH A;  3M7V A;  3BDG B;  1SHQ A;  1AUK A;  1EQJ A;  3IGZ B;  1URB A;  3NVL A;  3UO0 A;  1B8J A;  1EW8 A;  3T01 A;  1AJB A;  3D7S B;  2ANH A;  1ALJ A;  2GLQ A;  1ED9 A;  1FSU A;  1KHN A;  3OT9 A;  1EW2 A;  1E2S P;  1HQA A;  1O98 A;  3TX0 A;  2G9Y A;  3UN5 A;  3T02 A;  3UN2 A;  1ELY A;  4FDI A;  3TWZ A;  1ZED A;  3BDF A;  1HJK A;  1Y6V A;  1ZEB A;  1E1Z P;  1ANI A;  3CMR A;  1KHJ A;  1K7H A;  1KH5 A;  3IGY B;  3DPC A;  1KH4 A;  1N2L A;  1AJC A;  1O99 A;  3UN3 A;  3M8W A;  3ED4 A;  1EW9 A;  2IFY A;  1KHK A;  2QZU A;  1N2K A;  1ALH A;  1Y7A A;  3DYC A;  1ELZ A;  1ANJ A;  3SZZ A;  3D7S D; 
#chains in the KnotProt database with same CATH homology
 1ELX A;  1EJJ A;  3UNY A;  4FDJ A;  3MK2 A;  1KHL A;  1URA A;  1EI6 A;  1KH9 A;  1E3C P;  1ALK A;  3M8Z A;  1ALI A;  1ZEF A;  1ED8 A;  3MK0 A;  3BDG A;  3MK1 A;  1AJA A;  1E33 P;  3M8Y A;  3SZY A;  2GA3 A;  1HDH A;  1P49 A;  1AJD A;  1SHN A;  3T00 A;  1KH7 A;  3BDH A;  3M7V A;  3BDG B;  1SHQ A;  1AUK A;  1EQJ A;  3IGZ B;  1URB A;  3NVL A;  3UO0 A;  1B8J A;  1EW8 A;  3T01 A;  1AJB A;  2ANH A;  1ALJ A;  2GLQ A;  1ED9 A;  1FSU A;  1KHN A;  3OT9 A;  1EW2 A;  1E2S P;  1HQA A;  1O98 A;  3TX0 A;  2G9Y A;  3UN5 A;  3T02 A;  3UN2 A;  1ELY A;  4FDI A;  3TWZ A;  1ZED A;  3BDF A;  1HJK A;  1Y6V A;  1ZEB A;  1E1Z P;  1ANI A;  3CMR A;  1KHJ A;  1K7H A;  1KH5 A;  3IGY B;  3DPC A;  1KH4 A;  1N2L A;  1AJC A;  1O99 A;  3UN3 A;  3M8W A;  3ED4 A;  1EW9 A;  2IFY A;  1KHK A;  2QZU A;  1N2K A;  1ALH A;  1Y7A A;  3DYC A;  1ELZ A;  1ANJ A;  3SZZ A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling