3M8YA

Phosphopentomutase from bacillus cereus after glucose-1,6-bisphosphate activation
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 7-328 322 1-6 343-391 329-342 6 49 slipknot
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDTMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 5-326 322 1-4 330-391 327-329 4 62 slipknot
view details
3.1 6-331 326 1-5 339-391 332-338 5 53 slipknot
view details
3.1 6-338 333 1-5 345-391 339-344 5 47 slipknot
sequence length 391
structure length 391
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords Phosphopentomutase
source organism Bacillus cereus
total genus Genus: 143
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-03-19
KnotProt deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3m8yA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3m8yA01
1ANJA 1HQAA 1B8JA 3M7VA 1KH9A 1AJBA 3UO0A 1EQJA 1KHNA 1ELXA 1KH7A 1ED9A 3IGYB 1N2LA 3M8YA 4FDIA 2GA3A 1AUKA 1ELYA 2IFYA 3UN2A 1ANIA 3BDGA 1KHLA 1K7HA 3TX0A 1AJAA 3BDGB 1ALJA 3UNYA 1ALKA 2GLQA 1SHNA 1KHKA 1HDHA 1E1ZP 1EW9A 3DPCA 3UN3A 3SZYA 1HJKA 3SZZA 3T00A 3TWZA 1ZEDA 3ED4A 1ZEFA 3DYCA 2G9YA 3M8WA 1ELZA 1P49A 3UN5A 3T01A 1Y7AA 1SHQA 2ANHA 1ED8A 3CMRA 3IGZB 1FSUA 1EI6A 3MK1A 1AJCA 1URAA 3BDHA 1E33P 1ALIA 1KHJA 1ZEBA 1E3CP 3MK2A 1EW2A 4FDJA 1AJDA 1N2KA 3M8ZA 1O98A 1KH4A 1URBA 2QZUA 1O99A 1KH5A 1EW8A 3BDFA 3MK0A 1EJJA 3NVLA 1E2SP 3OT9A 3T02A 1Y6VA
chains in the KnotProt database with same CATH superfamily
1ANJA 1HQAA 1B8JA 3M7VA 1KH9A 1AJBA 3D7SB 3UO0A 1EQJA 1KHNA 1ELXA 1KH7A 1ED9A 3IGYB 1N2LA 3M8YA 4FDIA 2GA3A 1AUKA 1ELYA 2IFYA 3UN2A 1ANIA 3BDGA 1KHLA 1K7HA 3TX0A 1AJAA 3BDGB 1ALJA 3UNYA 1ALKA 2GLQA 1SHNA 1KHKA 1HDHA 1E1ZP 1EW9A 3DPCA 3UN3A 3SZYA 1HJKA 3SZZA 3T00A 3TWZA 1ZEDA 3ED4A 1ZEFA 3DYCA 2G9YA 3M8WA 1ELZA 1P49A 3UN5A 3T01A 1Y7AA 1SHQA 2ANHA 1ED8A 3CMRA 3IGZB 1FSUA 1EI6A 3MK1A 1AJCA 1URAA 3BDHA 1E33P 1ALIA 1KHJA 1ZEBA 1E3CP 3MK2A 1EW2A 4FDJA 1AJDA 1N2KA 3M8ZA 1O98A 1KH4A 1URBA 2QZUA 1O99A 1KH5A 1EW8A 3BDFA 3MK0A 1EJJA 3D7SD 3NVLA 1E2SP 3OT9A 3T02A 1Y6VA
chains in the KnotProt database with same CATH topology
1ANJA 1HQAA 1B8JA 3M7VA 1KH9A 1AJBA 3UO0A 1EQJA 1KHNA 1ELXA 1KH7A 1ED9A 3IGYB 1N2LA 3M8YA 4FDIA 2GA3A 1AUKA 1ELYA 2IFYA 3UN2A 1ANIA 3BDGA 1KHLA 1K7HA 3TX0A 1AJAA 3BDGB 1ALJA 3UNYA 1ALKA 2GLQA 1SHNA 1KHKA 1HDHA 1E1ZP 1EW9A 3DPCA 3UN3A 3SZYA 1HJKA 3SZZA 3T00A 3TWZA 1ZEDA 3ED4A 1ZEFA 3DYCA 2G9YA 3M8WA 1ELZA 1P49A 3UN5A 3T01A 1Y7AA 1SHQA 2ANHA 1ED8A 3CMRA 3IGZB 1FSUA 1EI6A 3MK1A 1AJCA 1URAA 3BDHA 1E33P 1ALIA 1KHJA 1ZEBA 1E3CP 3MK2A 1EW2A 4FDJA 1AJDA 1N2KA 3M8ZA 1O98A 1KH4A 1URBA 2QZUA 1O99A 1KH5A 1EW8A 3BDFA 3MK0A 1EJJA 3NVLA 1E2SP 3OT9A 3T02A 1Y6VA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1ANJ A;  1HQA A;  1B8J A;  3M7V A;  1KH9 A;  1AJB A;  3UO0 A;  1EQJ A;  1KHN A;  1ELX A;  1KH7 A;  1ED9 A;  3IGY B;  1N2L A;  3M8Y A;  4FDI A;  2GA3 A;  1AUK A;  1ELY A;  2IFY A;  3UN2 A;  1ANI A;  3BDG A;  1KHL A;  1K7H A;  3TX0 A;  1AJA A;  3BDG B;  1ALJ A;  3UNY A;  1ALK A;  2GLQ A;  1SHN A;  1KHK A;  1HDH A;  1E1Z P;  1EW9 A;  3DPC A;  3UN3 A;  3SZY A;  1HJK A;  3SZZ A;  3T00 A;  3TWZ A;  1ZED A;  3ED4 A;  1ZEF A;  3DYC A;  2G9Y A;  3M8W A;  1ELZ A;  1P49 A;  3UN5 A;  3T01 A;  1Y7A A;  1SHQ A;  2ANH A;  1ED8 A;  3CMR A;  3IGZ B;  1FSU A;  1EI6 A;  3MK1 A;  1AJC A;  1URA A;  3BDH A;  1E33 P;  1ALI A;  1KHJ A;  1ZEB A;  1E3C P;  3MK2 A;  1EW2 A;  4FDJ A;  1AJD A;  1N2K A;  3M8Z A;  1O98 A;  1KH4 A;  1URB A;  2QZU A;  1O99 A;  1KH5 A;  1EW8 A;  3BDF A;  3MK0 A;  1EJJ A;  3NVL A;  1E2S P;  3OT9 A;  3T02 A;  1Y6V A; 
#chains in the KnotProt database with same CATH topology
 1ANJ A;  1HQA A;  1B8J A;  3M7V A;  1KH9 A;  1AJB A;  3D7S B;  3UO0 A;  1EQJ A;  1KHN A;  1ELX A;  1KH7 A;  1ED9 A;  3IGY B;  1N2L A;  3M8Y A;  4FDI A;  2GA3 A;  1AUK A;  1ELY A;  2IFY A;  3UN2 A;  1ANI A;  3BDG A;  1KHL A;  1K7H A;  3TX0 A;  1AJA A;  3BDG B;  1ALJ A;  3UNY A;  1ALK A;  2GLQ A;  1SHN A;  1KHK A;  1HDH A;  1E1Z P;  1EW9 A;  3DPC A;  3UN3 A;  3SZY A;  1HJK A;  3SZZ A;  3T00 A;  3TWZ A;  1ZED A;  3ED4 A;  1ZEF A;  3DYC A;  2G9Y A;  3M8W A;  1ELZ A;  1P49 A;  3UN5 A;  3T01 A;  1Y7A A;  1SHQ A;  2ANH A;  1ED8 A;  3CMR A;  3IGZ B;  1FSU A;  1EI6 A;  3MK1 A;  1AJC A;  1URA A;  3BDH A;  1E33 P;  1ALI A;  1KHJ A;  1ZEB A;  1E3C P;  3MK2 A;  1EW2 A;  4FDJ A;  1AJD A;  1N2K A;  3M8Z A;  1O98 A;  1KH4 A;  1URB A;  2QZU A;  1O99 A;  1KH5 A;  1EW8 A;  3BDF A;  3MK0 A;  1EJJ A;  3D7S D;  3NVL A;  1E2S P;  3OT9 A;  3T02 A;  1Y6V A; 
#chains in the KnotProt database with same CATH homology
 1ANJ A;  1HQA A;  1B8J A;  3M7V A;  1KH9 A;  1AJB A;  3UO0 A;  1EQJ A;  1KHN A;  1ELX A;  1KH7 A;  1ED9 A;  3IGY B;  1N2L A;  3M8Y A;  4FDI A;  2GA3 A;  1AUK A;  1ELY A;  2IFY A;  3UN2 A;  1ANI A;  3BDG A;  1KHL A;  1K7H A;  3TX0 A;  1AJA A;  3BDG B;  1ALJ A;  3UNY A;  1ALK A;  2GLQ A;  1SHN A;  1KHK A;  1HDH A;  1E1Z P;  1EW9 A;  3DPC A;  3UN3 A;  3SZY A;  1HJK A;  3SZZ A;  3T00 A;  3TWZ A;  1ZED A;  3ED4 A;  1ZEF A;  3DYC A;  2G9Y A;  3M8W A;  1ELZ A;  1P49 A;  3UN5 A;  3T01 A;  1Y7A A;  1SHQ A;  2ANH A;  1ED8 A;  3CMR A;  3IGZ B;  1FSU A;  1EI6 A;  3MK1 A;  1AJC A;  1URA A;  3BDH A;  1E33 P;  1ALI A;  1KHJ A;  1ZEB A;  1E3C P;  3MK2 A;  1EW2 A;  4FDJ A;  1AJD A;  1N2K A;  3M8Z A;  1O98 A;  1KH4 A;  1URB A;  2QZU A;  1O99 A;  1KH5 A;  1EW8 A;  3BDF A;  3MK0 A;  1EJJ A;  3NVL A;  1E2S P;  3OT9 A;  3T02 A;  1Y6V A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling